KEGG   Loxodonta africana (African savanna elephant): 100654578
Entry
100654578         CDS       T04351                                 

Gene name
CUNH9orf3
Definition
(RefSeq) aminopeptidase O isoform X1
  KO
K09606  aminopeptidase O [EC:3.4.11.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100654578 (CUNH9orf3)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100654578 (CUNH9orf3)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100654578 (CUNH9orf3)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100654578
NCBI-ProteinID: XP_003407745
Position
Unknown
AA seq 819 aa
MDIKLDPSRDDLPLMANTSHILVKHYVLDLDVDFEHHVIEGTIVLFFEPGDKLKKQSSSS
EVTCPSESNEVHEFRMLESCHTPVTNTGTFSSKVGYNDITICGKRERDTSVEDDNHDNRE
QASGIPSSKCCFDTGNHGSENFLLVLDCCDLSVLKVEEVDVAAVPGIEKFTRSPQLMVVS
EELRNQIVHELAALPADRWREQLDYYAHCSQAPGCGELLFATDTWSLQIRKAGARTATDF
PRAIRIWYRTTPEGRSVTWTSDQSGRPCVYTMGSPINNRALFPCQEPPVAMSTWQATVRA
AASFVVLMSGENSAKPTQLREGFSSWHYYVTMPMPASTFTIAVGSWAEMQPEACSSDGLA
AERAFLPPEADFRYAGACGHMEYPCRFQNVSTTTQDIIPHRVFAPVSFRDVCQETLLQLI
PACLSAAHSILGTHPFSRLDVLIVPANFPSLGMASPHLIFLSQSTLTGSSHLCGTRLCHE
IAHAWFGLAIGARDWTEEWLSEGFATHLEDVFWAEAQQLAPQEAQEQQELRACLRWHRLR
DEVLNSAEELQVLRPNRENTGHVSDSGASVVKHGLNPEKTFMQVHYLKGYFLLRFLAKRF
GDETYFSFLRKFVHRFHGQLILSQDFLQMLLENVPEEKRLELSVENIFQEWLESSGLPKP
LQRERQAGAECGLVGQVSTEVTKWIRTNQRPRKRKRRENKEVFAKLLPDQLVLLLERLLE
QKTLHPQTLQSLQQTYRLPEQDAEVRHRWCELIVKHRYTKAYGQVERFLRGDQAMGTYLY
GELMVSEDARQQQLARKCFELTKEQMDRASAQVVAEMLF
NT seq 2460 nt   +upstreamnt  +downstreamnt
atggacataaagctggacccttcccgagatgacctacctctcatggccaacaccagccac
atccttgtgaagcactatgtactggatttagacgtggattttgagcatcacgtcattgag
ggcaccatagtgctttttttcgagcctggagacaaactcaagaaacagagtagttcctct
gaggtaacctgcccatcggagtcgaacgaagtccatgaatttaggatgcttgaatcctgc
catactcctgtgacaaacacagggaccttctcatctaaagtgggatataatgatattaca
atctgtggtaaacgtgaaagagatacttctgtcgaagatgataaccatgacaaccgggaa
caggcttctgggattcctagttcaaagtgctgctttgacacggggaatcatgggagtgag
aattttttgctagtgttggactgctgtgatttatctgtgttgaaggttgaagaggtggat
gttgctgctgtgccaggtattgaaaaatttacaaggtctccccagctcatggttgtttct
gaggagctcaggaatcagattgtacatgaactcgcggctctgcctgcagatcgttggagg
gagcagttagactattatgcacactgcagccaggctcccggctgtggggaactcctgttt
gccaccgacacgtggagcttacagatcaggaaggcaggggctcggacagccactgacttc
cctcgcgccataaggatatggtacagaaccacacccgaggggagatcagttacgtggacc
tcagaccagagtggcaggccatgtgtttataccatgggatcccccataaacaacagggcc
ctttttccatgccaggagccacccgttgccatgtcaacatggcaggccacagttcgagca
gctgcatcttttgttgttttaatgagtggggaaaattctgccaagccaacacagcttcgg
gaagggttctcgagctggcattactacgtaaccatgccaatgccagcctccaccttcacc
attgcagtgggatcgtgggcagaaatgcagccagaggcctgctcatcagacggtctggca
gcagagagagccttcctacctcccgaggccgacttcaggtatgctggtgcttgcggtcat
atggaatatccctgccgcttccagaatgtttccaccaccacgcaggacatcattcctcat
cgggtctttgctccagtgtccttcagagatgtctgtcaagagacccttctgcagctgatc
cctgcttgcctctcagcagcacattctatcctgggaacacacccgttctccaggctggat
gtactaattgtccctgccaactttccaagtctggggatggccagcccacacctcatcttc
ctctcccagagcaccttgactggaagcagccacctctgtgggacccgcctttgccatgag
attgcccacgcctggtttggcctagccattggggcccgagactggacagaggagtggctg
agtgaagggtttgccactcacttggaggatgtattttgggctgaagcacagcagctggcc
ccccaggaggcccaggagcagcaagagctgcgcgcctgcctgcgctggcaccgcctccgg
gacgaggtgctgaactcggctgaagagctgcaagtgctaagacctaacagagagaacact
gggcacgtgagtgactcaggagcatcggttgtcaaacatggactcaatccagagaagact
ttcatgcaggttcattatttgaagggctatttccttcttcgtttccttgccaaaagattt
ggagatgaaacctatttttcgtttttaagaaaatttgtgcacagatttcatggacagttg
attctttcccaggatttccttcaaatgctgttggagaacgtcccagaagaaaaaaggctc
gagttgtctgttgaaaacatcttccaagagtggcttgagagttccggattaccaaagccg
ttgcagagggagcgccaggccggggcggagtgcgggctcgtggggcaagtgagcaccgag
gtcacgaaatggattcgcacgaaccagagacccagaaaacggaaacgaagggagaacaag
gaggtgtttgcaaagcttcttccagaccagctggtcttgcttctggagcgtctcttggag
cagaagaccctgcacccgcaaaccctgcaaagcctccagcagacataccgcctccctgag
caggatgcagaggtccgccatcgctggtgtgagctcattgtcaaacacagatacactaaa
gcgtatggacaggtggagcgcttcctgcggggggaccaggccatgggcacctacctctac
ggcgagctgatggtgagcgaggatgcccggcagcaacagctcgcccgcaagtgcttcgag
ctgaccaaggagcagatggacagagcctcagcccaggtggtggctgagatgctcttttag

DBGET integrated database retrieval system