KEGG   Loxodonta africana (African savanna elephant): 100654634Help
Entry
100654634         CDS       T04351                                 

Gene name
TNFRSF13C
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04064  NF-kappa B signaling pathway
lav04672  Intestinal immune network for IgA production
lav05166  Human T-cell leukemia virus 1 infection
lav05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100654634 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100654634 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100654634 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100654634 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100654634 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lav04050]
    100654634 (TNFRSF13C)
   04090 CD molecules [BR:lav04090]
    100654634 (TNFRSF13C)
Cytokine receptors [BR:lav04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100654634 (TNFRSF13C)
CD molecules [BR:lav04090]
 Proteins
  100654634 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 100654634
NCBI-ProteinID: XP_023415649
Position
Unknown
AA seq 86 aa AA seqDB search
MGLVRLVRWRRRRRGMAPPEASDRYPNESLDNVIILSPGPIDATSPVWSPPEDRATTLPG
HSVPVPATELGSTELVTTKTTGPEQL
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggtgcgcctggtgaggtggaggcggcgccggcgcgggatggcgcccccggag
gcctccgaccgctacccgaacgagtccctggacaatgtcatcatcctctcccctggaccc
attgatgccacaagtcctgtctggtctccacctgaagacagagccaccaccctacctggc
cacagtgtccctgtgccagccacagagctgggttctactgagctggtgaccaccaagaca
actggccctgagcagctgtag

DBGET integrated database retrieval system