KEGG   Loxodonta africana (African savanna elephant): 100656539
Entry
100656539         CDS       T04351                                 

Gene name
RNPEPL1
Definition
(RefSeq) LOW QUALITY PROTEIN: aminopeptidase RNPEPL1
  KO
K09605  arginyl aminopeptidase-like 1 [EC:3.4.11.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100656539 (RNPEPL1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100656539 (RNPEPL1)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100656539 (RNPEPL1)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N DUF2268
Other DBs
NCBI-GeneID: 100656539
NCBI-ProteinID: XP_023396077
Position
Unknown
AA seq 557 aa
MRYTSTDAPAIWWLEPELTYGHEKPFVFTQGHSVCNRSFFPCFDTPAVKCTYSAVVKAPS
GXQVLMSATRSTYVRRXGCVPLHMEHPVPAYLVVCTCGQVCPGCVWSAGCLGECTPMGSL
ELPMPTLPFWGTGWHGCSRPGPSAAHLPGRYDIVFLPPSFPIVAMENPCLTFIISSILES
DEFLIIDVIHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAAFTCLETAFR
LDALHRQMKLLGEDSPVSKLQAKLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGDPQRFD
DFLRAYVEKYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDL
SQGSSLTRPVETLFQLWTAEPLDQVAASASTIDISKWRTFQTALFLDRLLDGSPLPQEVV
TSLSKCYSSLLDSMNAEIRIRWLQLVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCT
GALKPFALEVFYQTQGQLHPNLRRTIQQILSQGLGPGVELAAEPSTERDTGADTPALLLS
DEAPGSAISLRDVNVSA
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgcgatacacctccaccgacgcccccgccatctggtggctggagccggagctgacctac
ggccatgagaagcccttcgtgttcacccagggccactccgtgtgcaaccgttccttcttc
ccctgctttgacacaccagctgtcaagtgcacctactcggccgtcgtcaaggctccctca
gggntgcaggtgctgatgagcgccacccggagcacgtatgtgaggaggnnagggtgtgta
ccgcttcacatggagcaccccgtgcctgcctacctcgtggtctgcacatgtgggcaggta
tgtcctgggtgtgtctggagcgctggttgcctgggagagtgtactcctatgggatccctt
gagttacccatgcccaccctacctttttggggtacagggtggcatggatgttccaggcca
ggcccctcagctgctcacctgcctggcaggtacgatatcgtcttccttccgccctccttt
cccatcgtggccatggagaacccctgcctcaccttcatcatctcctctatcctggagagc
gacgagttcttgatcattgacgtcatccacgaggtggcgcacagctggtttggcaacgcc
gtcaccaatgcaacctgggaggagatgtggctaagtgaaggcttggccacctacgcgcag
cggcgcatcaccaccgagacctatggtgcagccttcacctgtctggagacggccttccgc
ctggatgccctgcaccggcagatgaagctgctgggagaggacagcccggtcagcaagctg
caggccaagctggagccaggagtgaaccccagccacctgatgaatctgtttacctacgag
aagggctactgcttcgtgtactacctatcccagctctgcggagacccccagcgctttgac
gactttctccgcgcctatgtggagaagtacaagttcaccagcgtggtggcccaggacctg
ctggactccttcctcagcttcttcccagagctgaaggagcagagcgtggactgccgggca
gggctggaattcgagcgctggctcaacgccacgggccctccgctggcggagccggacctg
tctcagggatccagcctgactcggccagtggagaccctcttccagctgtggacggcagag
cccctggaccaggtggccgcctcggccagcaccatcgacatctccaagtggaggaccttc
cagacagcgctcttcctggaccggctgctggacgggtccccgctgccccaggaggtggtg
acaagcctgtccaagtgctactcgtccttgttggactcgatgaacgccgaaatccgcatc
cgctggctacagctggtggtccgcaatgactactaccctgacctgcacagggtgcggcgc
ttccttgagagccagatgtcacggatgtacaccatcccgctgtacgaggacctctgcacc
ggcgccctcaagcccttcgccctggaggtcttctaccagacacagggccagctgcacccc
aacctgcgcagaaccatccagcagatcctgtcccagggcctgggcccaggcgtggagctg
gctgcagagcccagcaccgagcgggacacaggcgctgatacgccggccctgctgctcagt
gacgaggcccccggcagtgccatctctctcagggacgtcaacgtgtctgcctag

DBGET integrated database retrieval system