KEGG   Loxodonta africana (African savanna elephant): 100657753Help
Entry
100657753         CDS       T04351                                 

Definition
(RefSeq) regulatory-associated protein of mTOR isoform X1
  KO
K07204  regulatory associated protein of mTOR
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04136  Autophagy - other
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100657753
   04152 AMPK signaling pathway
    100657753
   04150 mTOR signaling pathway
    100657753
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100657753
   04136 Autophagy - other
    100657753
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100657753
  09149 Aging
   04211 Longevity regulating pathway
    100657753
   04213 Longevity regulating pathway - multiple species
    100657753
  09159 Environmental adaptation
   04714 Thermogenesis
    100657753
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100657753
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100657753
Membrane trafficking [BR:lav04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100657753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT HEAT_2 Cnd1
Motif
Other DBs
NCBI-GeneID: 100657753
NCBI-ProteinID: XP_023412577
Position
Unknown
AA seq 1286 aa AA seqDB search
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEAAELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLIHDGSPVVR
KVRAPPPAMVCNARGPSPSPMELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAAA
EGGSLTPVRDSPCTPRLRSVSSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLS
TSSSTSSTLGSPENEEYILSFETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAA
DPYPDVSDLAMKVLNSIAYKMKAPHQTSRFYLVTPVSLLPGPPVTVSSVFQATVNARPQR
ILDTASLTQSAPASPTNKGTHIQPVGGSPPTSSTSSSSLTNDVAKQPISRDLPTGRPGAS
GPMGAQYTPHSHQFPRTRKMFDKGPDQTTDDADDAVGHKSFISAAVQTGFCDWSARYFAQ
PVMKIPEEHDLESQTRKEREWRFLRNSRVRRQAQQVIQRGITRLDDQIFLNRNPGVPSVV
KFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATD
DGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGLARKVSICLDSSKQGGAGMVVDWEQ
ETGLLMSSGDVRIIRIWDTDREMKVQVRAPGAGRDVGGKGLRYLPTSLASWSSAPPQHLI
WAEPTIHSTKQTPSLAMKDREGWLVL
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgagatgctgcagtcgcctcttctgggacttggggaggaagatgaggccgac
cttacagactggaacctgcctttggcttttatgaaaaagaggcactgtgagaagattgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagactgtcagtgtt
gccttggtgttgtgcctcaatgttggtgtggaccccccggatgtggtgaagaccaccccc
tgtgcccgtttagaatgctggatagatcctctgtcaatgggcccgcagaaagctctggaa
accattggcgccaatttacagaagcagtacgagaactggcagccgagggcccggtacaag
cagagccttgacccaactgtggatgaagtcaagaagctttgcacatctttgcgcagaaac
gccaaggaggagcgagttctcttccactacaacggccacggggtaccccggcccactgtg
aacggcgagatctgggtcttcaacaagaactacacacagtacatccctctgtccatatat
gacctacagacctggatgggcagcccgtccatatttgtctacgactgctccaacgccggc
ctcatcgtcaagtccttcaagcagtttgcactgcagagggagcaggagctggaggtcgca
gccattaacccaaaccacccactcgcccagatgcccttgccgccatcgatgaagaactgc
atccagctggctgcctgcgaggccgccgagctgctgcccatgatccctgacctgccagcc
gacctcttcacgtcctgcctcaccacgcccatcaagatcgccctgcgctggttttgcatg
cagaaatgtgttagtctggtgccaggagtcacactggatttgatagaaaagatccccggg
cggctgaacgaccggcgtacgccactgggtgagctgaactggatcttcacggccatcacg
gacactatcgcctggaacgtgctcccccgagatctcttccagaagctcttccgacaggac
ctgctggtggcaagtctgttccgaaatttcttgttagcagaaaggatcatgaggtcctac
aactgcaccccagtgagcagcccgcgactgccccccacatacatgcatgccatgtggcaa
gcttgggacctcgctgtggacatttgtctctctcagctgccaacgattattgaggaaggc
acagcgtttcggcacagccccttctttgctgagcagctgaccgcgttccaggtatggctt
acaatgggcgtggagaacaggaacccccctgaacagctccccattgttctgcaggtgctg
ttaagccaagtgcatcggctgagagccctggacttgctgggaagatttttggacttgggt
ccctgggcggtgagcctggccttgtctgtcggcatttttccttacgttctgaagctgctt
cagagttcagcccgggagctgcggcccctcctggtgttcatatgggccaagatccttgct
gttgacagttcgtgccaagctgacctcgtgaaggacaatggccacaagtacttcctctca
gtcttggcggacccctacatgccagccgagcatcggaccatgacggccttcatcctggct
gtgattgtcaacagctacaacacggggcaagaagcctgccttcagggaaacctgattgcc
atctgcctggagcagctcagcgacccccaccctctgctgcgccagtgggtggccatctgc
ctcggacggatctggcagaacttcgactcagcgaggtggtgtggcgtgcgggacagtgca
cacgagaagctctacagcctcctctcggaccccattcctgaggtccggtgtgctgccgtc
ttcgccctgggcacattcgtgggcaactctgcagagaggaccgaccactccaccaccatc
gaccacaacgtggccatgatgctggcccagcttatccacgacggcagtcctgtggtgcgc
aaggtgcgtgccccgccccccgcaatggtgtgcaacgcacgtggtccatccccttctccc
atggagctggtggtggcactgagtcacctcgtggttcagtacgagagcaatttctgcact
gtcgccctgcagttcatggaggaggaaaagaactaccccttgccatccccagcggccgca
gaggggggtagcttgacccccgtgcgggacagcccgtgcacccccagactccgctcggtg
agctcctacggaaacatccgtgctgtcaccactgcccggagcttgaacaagtctctgcag
aacctgagcctgaccgaggaatccggcagctcagtggccttctcgcccgggaacctgagc
accagcagcagcaccagcagcaccctgggcagccccgagaacgaggagtacatcctgtcc
tttgagaccatcgacaagatgcggcgcgtcagctcctactcctccctcaactctctcatc
ggagtttcttttaatagtgtttacacccaaatttggagagtgttactgcacctggctgcc
gacccatacccagacgtgtcagatttggctatgaaagtcctcaacagcatcgcctataag
atgaaggccccccaccagacctcacgcttttatctcgtgaccccagtgagcctccttcct
ggacccccggttactgtgtcttcggtcttccaggccacggtgaacgcccggccccagcgc
atcctcgacacggcctccctcacgcagtcggccccggccagccccaccaacaagggcacg
cacatccagcccgtggggggctccccaccaacgtccagcacaagcagctccagcctgacc
aatgatgtggccaagcagccgatcagccgtgacctgcccacaggccggccgggcgcctcg
ggccccatgggggcgcagtacacaccccactcccaccagttcccccggacgcggaagatg
ttcgacaagggcccagaccagaccacagacgatgccgatgatgctgtggggcacaagagc
ttcatctccgctgcggtacagacgggcttctgcgactggagcgccagatactttgcccag
cccgtcatgaagattccagaagagcatgacctagagagtcagacccgcaaggagcgtgag
tggcggttcctgcgcaacagccgcgtacggaggcaggcgcagcaggtcatccagaggggc
atcacccgactggacgaccagatattcctcaataggaacccaggagtcccctcagtggtc
aagttccacccattcacaccgtgtgtcgccgtggctgacaaagacagtatctgtttctgg
gactgggagaaaggggagaagctggattacttccacaatgggaatcctcggtacaccagg
gtcaccgccatggagtacctgaatggccaggactgctcactcctgctgacggccaccgac
gacggcgccatcagggtctggaagaactttgctgacttggagaagaaccccgaaatggtg
actgcgtggcaggggctctcagacatgctgccgacaacgcgaggtctggctcgaaaggtt
tccatctgtcttgacagcagtaagcagggaggagccgggatggtggtggactgggagcag
gagaccgggctcctcatgagctcaggggacgtgcgaatcatccggatctgggatacggac
cgtgagatgaaggtgcaggtaagggcgcctggagcaggcagggatgtgggtgggaagggg
ctccgatacctgcccacctctctggcctcctggagctcagctccacctcagcacctgatc
tgggcagagcccaccatccactccacaaagcagactccttccctagccatgaaggaccga
gaaggatggttggttctgtga

KEGG   Loxodonta africana (African savanna elephant): 100660112Help
Entry
100660112         CDS       T04351                                 

Gene name
MTOR
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04066  HIF-1 signaling pathway
lav04072  Phospholipase D signaling pathway
lav04136  Autophagy - other
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04371  Apelin signaling pathway
lav04630  Jak-STAT signaling pathway
lav04659  Th17 cell differentiation
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04920  Adipocytokine signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05221  Acute myeloid leukemia
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100660112 (MTOR)
   04371 Apelin signaling pathway
    100660112 (MTOR)
   04630 Jak-STAT signaling pathway
    100660112 (MTOR)
   04066 HIF-1 signaling pathway
    100660112 (MTOR)
   04072 Phospholipase D signaling pathway
    100660112 (MTOR)
   04151 PI3K-Akt signaling pathway
    100660112 (MTOR)
   04152 AMPK signaling pathway
    100660112 (MTOR)
   04150 mTOR signaling pathway
    100660112 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100660112 (MTOR)
   04136 Autophagy - other
    100660112 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100660112 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100660112 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100660112 (MTOR)
   04920 Adipocytokine signaling pathway
    100660112 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    100660112 (MTOR)
   04919 Thyroid hormone signaling pathway
    100660112 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100660112 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100660112 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100660112 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100660112 (MTOR)
   05206 MicroRNAs in cancer
    100660112 (MTOR)
   05205 Proteoglycans in cancer
    100660112 (MTOR)
   05230 Central carbon metabolism in cancer
    100660112 (MTOR)
   05231 Choline metabolism in cancer
    100660112 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100660112 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100660112 (MTOR)
   05212 Pancreatic cancer
    100660112 (MTOR)
   05225 Hepatocellular carcinoma
    100660112 (MTOR)
   05226 Gastric cancer
    100660112 (MTOR)
   05214 Glioma
    100660112 (MTOR)
   05221 Acute myeloid leukemia
    100660112 (MTOR)
   05215 Prostate cancer
    100660112 (MTOR)
   05224 Breast cancer
    100660112 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100660112 (MTOR)
   05016 Huntington disease
    100660112 (MTOR)
   05017 Spinocerebellar ataxia
    100660112 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100660112 (MTOR)
   04931 Insulin resistance
    100660112 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100660112 (MTOR)
   05168 Herpes simplex virus 1 infection
    100660112 (MTOR)
   05163 Human cytomegalovirus infection
    100660112 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100660112 (MTOR)
   05165 Human papillomavirus infection
    100660112 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100660112 (MTOR)
   01522 Endocrine resistance
    100660112 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100660112 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100660112 (MTOR)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100660112 (MTOR)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100660112 (MTOR)
Membrane trafficking [BR:lav04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100660112 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 IFRD UME V-ATPase_H_N TMEM154 EPSP_synthase HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 100660112
NCBI-ProteinID: XP_023407833
Position
Unknown
AA seq 2550 aa AA seqDB search
MLGTGPAAATTATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSQHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSSGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLDYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKVDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHTSGANITNTTTAATMAATATATATSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSASQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPIQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaacaggacctgccgccgccaccacggccaccaccacatccagcaatgtgagc
gttctgcagcagtttgccagtggcctgaagagccgcaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggaactccgagagatgagtcaagaggagtct
acccgcttctatgatcagctgaaccatcacatttttgaattggtctccagttccgatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggagggaat
gccacccgaatcggcagatttgctaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccattggtcgcctagccatggcaggggacactttc
accgctgagtatgtggagtttgaggttaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacatgcagctgttctggtgctccgtgagctggccatcagcgtcccc
accttcttctttcagcaagtgcaacccttctttgacaacatatttgtggccgtgtgggac
cccaagcaggccatccgggagggagctgtagctgccctccgcgcctgtctaattctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagaaaaagggtttgatgagaccttggccaaggagaagggcatgaatcgggatgaccgc
atccatggagccttgctgattctcaacgagttggtccgcatcagcagcatggagggagag
cgtctaagagaagaaatggaagaaatcacacagcagcagctggtacatgacaagtactgc
aaagatctcatgggcttcgggacgaaacctcggcacatcaccccctttaccagtttccag
gctgtacagccccagcagtcaaacgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttgggacttcccctagcccagctaaatccactctagtggaaagccgg
tgttgcagagacttgatggaagagaagtttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgctgccccgcttagct
gcattccgaccttctgccttcacagatacccagtacctccaagataccatgaaccatgtc
ctaagctgtgtcaaaaaggaaaaggaacgtacagcagccttccaggccctggggttactt
tctgtggctgtgaggtctgagtttaaggtctatttacctcgtgtgctggacatcatccga
gcagccttgccccctaaggacttcgcccataagagacagaaggcaatgcaggtggatgcc
acggtgttcacctgtatcagcatgctagctcgggcaatggggcctggcatccagcaggat
atcaaggagctgctggagcctatgctagcagtgggactgagccctgctctcactgcagtg
ctctatgacctgagccgtcagatcccacagctgaagaaggacatccaagatgggctactg
aagatgctgtccttggtcctcatgcacaaaccccttcggcacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacaaccctccctgaggccagtgatgtgggc
agcatcactcttgctcttcgaactcttggcagctttgaattcgaaggccactctctgacc
cagtttgtccgccactgtgcggatcatttcctgaacagtgagcacaaggagatccgcatg
gaagctgcccgcacctgctcccggctgctcacaccctccatccacctcatcagtggccac
gctcatgtggttagccagactgcggtgcaagtagtggcagatgtgctcagcaaactgctc
gtggttgggataacagatcctgaccctgacatccgctactgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggcagagaacttgcaggccctgtttgtggcgctg
aacgaccaggtgtttgagatccgggagctggccatctgcactgtgggccgactcagtagc
atgaacccagcctttgtcatgccttttctgcgcaagatgctcatacagatcttgacagag
ctggaacacagtggcattggaagaatcaaagagcagagtgcccgcatgctgggacacctg
gtctccaatgctccccgactcatccgtccctacatggagcctattttgaaggctttaatt
ttgaaactgaaagacccagaccctgatccaaaccctggtgtgatcaataatgtcttggct
acaataggagaattggctcaggttagtggcctagaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaggactcttctcttttggctaaaaggcaggtggct
ctgtggaccctgggacaattggtggccagcactggttatgtggtagagccctacaggaag
taccccacactgcttgaagttttgctgaactttctgaagactgagcagaaccagggtacc
cggagagaggccattcgtgtgttagggctcctgggggctttggatccctacaagcacaaa
gtgaacattggcatgattgaccagtcccgggacgcttctgctgtcagcctgtcagaatct
aagtcaagtcaggattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgcctctggacgagttctacccagccgtttccatggtggccctgatgcggatcttccgg
gaccagtccctctctcagcatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattccttaatgtc
attcgggtctgtgatggggccatccgggagtttctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttacatggatgaaatagttaccctcatgagagaa
ttctgggtcatgaatacctcaatccaaagcacaatcattcttcttattgagcaaattgtg
gtagctcttgggggtgagtttaaactctacctgccccagctgatcccgcatatgcttcga
gtcttcatgcatgacaacagctcgggccgcattgtctctatcaagttgttggctgcaatc
cagctgtttggcgctaacctggatgactatctgcatttgttgttgcctcctattgtgaag
ttgtttgatgcccccgaagttccactaccatctcgaaaggcagccttagagacagtggac
cgcctgacggagtccttggatttcaccgactatgcctcacggatcattcaccctattgtt
cgcacactggaccagagcccagaactgcgtcccacagccatggacacattgtcttcactt
gtctttcagctggggaagaagtaccaaattttcattccaatggtgaataaagttctcgtg
cgacaccgaatcaaccatcagcgctatgacgtgctcatctgcagaattgtcaagggatac
acccttgctgatgaagaggaggaccctttgatttaccagcatcgaatgctgaggagcggc
caaggggatgcactggctagtggaccagtagagacaggacccatgaagaaactgcatgtc
agcacgattaacctccaaaaggcctggggagctgccagaagggtttccaaagatgactgg
ctggaatggctaagacgactgagcctggaactactgaaggactcctcatctccttccctg
cgctcatgctgggccctggcacaggcctacaacccgatggccagggacctattcaatgct
gcatttgtgtcctgctggtctgaattgaatgaagaccagcaggatgagctcatcagaagc
atcgagttggccctcacctctcaagacattgctgaagtcacgcaaaccctcctaaacttg
gctgaattcatggaacacagtgacaaaggcccactgccactgagagatgacaatggtatt
gtcctgctgggtgagagagctgccaagtgccgagcgtatgccaaagcactgcactacaaa
gaactggagttccagaaaggccccactcccgccatcctagagtctctcattagcattaat
aataagctacagcagccagaggcagctgccggggtgttagactatgccatgaaacacttc
ggagagctggagatccaggctacctggtatgagaagctgcacgagtgggaggatgccctc
gtggcctatgataagaaagtggacaccaacaaggatgaccccgagctgatgctgggccgc
atgcgctgccttgaggccttgggggaatgggggcagctccaccagcagtgttgtgaaaag
tggaccctggttaatgatgaaactcaggccaagatggcccggatggctgctgcagccgca
tggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgggacacc
catgatggggcattttatagagccgtgctggcgctacatcaagacctcttctcattggcg
caacagtgcatcgacaaagccagggacctgctggatgctgagttaactgctatggcaggg
gagagctatagtcgggcgtatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgtgaaatcatccgccagatctggtgg
gaaagactgcagggctgccagcgtattgtcgaggactggcagaaaattcttatggtacgc
tcccttgtagttagccctcatgaggacatgagaacatggctcaagtatgcaagcctgtgt
ggcaagagtggcaggctggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccatctcggcagcttgatcatcctctgccaacagttcatcctcaggtgacctatgcatac
atgaaaaacatgtggaagagcgctcgcaagatcgatgccttccagcacatgcagcacttc
gtccagaccatgcagcagcaggcccagcatgccatcgccaccgaggaccagcagcacaag
caagagctgcacaagctgatggcccgatgttttctgaagcttggggagtggcagctgaac
ctccagggcatcaatgagagcacaatccccaaagtcctgcagtactacagtgccgccaca
gagcatgaccgcagctggtacaaggcctggcacgcgtgggcagtgatgaactttgaagct
gtgctacactacaaacaccagaaccaagcccgtgatgagaagaagaaactgcgtcacacc
agcggggccaacatcaccaataccaccactgctgccaccatggcagccactgccactgcc
actgccaccagcaccgagggcagcaacagtgagagtgaggccgagagcactgagaacagc
cctaccccgtctcccctgcagaagaaggtcactgaggatttgtccaagaccctcttgatg
tacactgtccctgccgtccagggcttcttccgttctatctctttgtcacgaggcaacaac
ctccaggatacactcagagtcctcactttatggtttgattatggtcactggccagatgta
aatgaagctttagtggaaggggtgaaagcaatccagattgatacttggttacaggttata
cctcagctcattgcgagaattgatacacccaggcccttggttggacgtctcattcaccag
cttctcactgacattgggcgatatcacccccaggccctcatctaccccctgactgtggca
tctaagtcaaccaccacagcccgtcacaatgcagccaacaagattctgaagaacatgtgt
gaacacagtaacaccctggtacagcaggccatgatggtgagtgaggagctgattcgagtg
gccatcctctggcatgagatgtggcacgaaggcctggaagaagcgtctcgcttgtacttt
ggggagaggaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaa
cgggggccccagacgctgaaggaaacatcctttaatcaggcatatggtcgagatttaatg
gaggcccaagagtggtgcaggaagtacatgaaatcaggcaatgtcaaggacctcacccaa
gcctgggacctctattatcatgtgttcagacgaatctcaaagcaactgcctcagctcaca
tccttagagctgcagtacgtctccccaaaacttctgatgtgccgggaccttgaattggct
gtgccaggaacgtatgaccccaaccagccgatcattcgcattcagtccatagcaccgtct
ttgcaagtcatcacatccaagcagaggccccggaagttgacacttatgggcagcaatggg
cacgagtttgttttcctcctgaagggccatgaagacctacggcaagatgagcgagtgatg
cagctctttggcctggttaacaccttgctggccaatgacccaacctctctccggaaaaac
ctcagtatccagagatatgccgtcatccccttatcaaccaactcgggcctaatcggctgg
gtcccccactgtgacacgctgcatgccctcatccgggactacagggagaaaaagaagatc
ctcctcaacattgagcatcgcatcatgttgcggatggctccagactatgaccacttgact
ctgatgcagaaggtggaggtgttcgaacacgctgtcaacaacaccgccggggacgacctg
gccaagctgctgtggctgaagagccccagttcagaggtgtggtttgaccgaagaaccaat
tatacccgctctttagcagtcatgtcaatggttggatatattttgggcctgggagatagg
cacccatctaacctgatgctcgaccggctgagtgggaagatcctgcacattgactttggg
gactgctttgaggttgctatgaccagggagaaattcccggagaagattccatttagacta
acaagaatgttgaccaatgcaatggaggttactggcctggatggcaactacagaatcaca
tgccacacggtgatggaagtgctccgggaacacaaggatagtgtcatggctgtgctggaa
gccttcgtctatgaccccttgctgaactggaggctgatggacacgaataccaaaggcaac
aagcgatcccgaacaaggacagattcctactctgccagccagtcagtagaaattttggac
ggtgtggagcttggggaaccagcccataagaaaacgggaaccacagtaccagaatctatt
cattctttcattggagacggtttggtgaaaccagaggccctaaataagaaagccattcag
ataattaacagggttcgagataagctcactggtcgagacttctctcatgatgaaactttg
gatgttccaatccaagttgagctgctcatcaaacaagcaacatcccatgaaaacctctgc
cagtgctatattggatggtgtcctttctggtaa

DBGET integrated database retrieval system