KEGG   Loxodonta africana (African savanna elephant): 100659049Help
Entry
100659049         CDS       T04351                                 

Gene name
HSD3B2
Definition
(RefSeq) LOW QUALITY PROTEIN: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00140  Steroid hormone biosynthesis
lav01100  Metabolic pathways
lav04913  Ovarian steroidogenesis
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Module
lav_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
lav_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100659049 (HSD3B2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100659049 (HSD3B2)
   04925 Aldosterone synthesis and secretion
    100659049 (HSD3B2)
   04927 Cortisol synthesis and secretion
    100659049 (HSD3B2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100659049 (HSD3B2)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     100659049 (HSD3B2)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     100659049 (HSD3B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind Ilm1
Motif
Other DBs
NCBI-GeneID: 100659049
NCBI-ProteinID: XP_003409483
Position
Unknown
AA seq 373 aa AA seqDB search
MTEWSCLITRSRGFXGQRIISLWXREKELQEIRALDKVFRPELQEEFSKLKHKVKLTMLE
GDILDEQCLKRACQGISVVIHSASIIDVTGAIQREAIMNVNLKGTQLLLEACVQANVPIF
IYTSTIEVAGPNSYSEIIQNGHEEEHLESKWSTAYPYSKKLAEKVVLAADGWTLKNGGTL
YTCSLRPMYIYGEGNPFICRQINQALQNNGILKNFAKHSLVNPVYVGNVAWAHILALKAL
LDPKKAPSIRGQFYYISDDTPHESYSKFNYILSKEWGLHIDSGMTLPVSLQYWIAFLLEI
VSSLLSPIYEYQPPFTRHLVTLSNSVFTFSYKKAQQDLGYKPLYSWEEAKQKTTQWVGSL
VKEHKEALKKKTH
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtggagctgccttataacaaggagcagagggttcnntggtcagaggatcatc
agcttgtggnncagagagaaagagctgcaggaaattcgagccctggacaaggtcttcaga
ccggaattacaagaagaattttctaagcttaagcacaaggtgaagctgacaatgctggaa
ggagacatcctggatgagcagtgcctgaagagagcctgccagggcatctcggttgtcatt
cactccgcctctatcattgatgtgacgggggccattcagagagaagccatcatgaatgtc
aatctgaaaggtacccagctcttattggaagcctgcgtccaggccaatgtgccaatattc
atctataccagcaccatagaggtggctgggcccaactcctacagtgagatcatccagaat
ggccatgaagaagaacatcttgaatctaaatggtctactgcatacccatacagcaaaaag
cttgccgagaaggttgtgctggcagctgatggctggactcttaaaaatggtggcactttg
tacacttgttccttaaggcccatgtatatctatggggaaggaaacccattcatttgtaga
caaataaaccaggccttgcagaacaatggcatcctgaagaattttgccaagcactcccta
gtcaacccagtctatgttggcaatgtggcctgggctcacattctggccttgaaagccttg
ctagatcccaagaaagccccaagcatccgaggacagttctactacatctcggatgacacg
cctcacgagagctatagtaaattcaactacatcctgagtaaagaatggggtctccacatt
gattccggaatgacccttcctgtatctctgcagtattggattgccttcctgctggaaata
gtgagctccctgctgagcccaatctatgaatatcaaccccctttcacccgccacctggtg
acattgtcaaatagtgtgttcacattctcctacaagaaagcccagcaagatctggggtat
aagccactctacagctgggaggaagccaagcagaaaaccacccagtgggttggctctctg
gtgaaagagcacaaagaggccctgaagaaaaaaactcactga

DBGET integrated database retrieval system