KEGG   Loxodonta africana (African savanna elephant): 100659832Help
Entry
100659832         CDS       T04351                                 

Gene name
CUNH2orf49
Definition
(RefSeq) ashwin isoform X1
  KO
K15432  ashwin
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lav03016]
    100659832 (CUNH2orf49)
Transfer RNA biogenesis [BR:lav03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing ligases
    100659832 (CUNH2orf49)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ashwin
Motif
Other DBs
NCBI-GeneID: 100659832
NCBI-ProteinID: XP_003413660
UniProt: G3T397
Position
Unknown
AA seq 232 aa AA seqDB search
MAGDVGGRSCPDSELLLHPELLSQEFLLLTLEQKNIAVENDVRINKDNLTDLYVQHAIPL
PQRDLPKNRWGKMMEKKREQHEMKHETKRSATVDGLRKRPLIVFDGSSTSTSIKVKRTEN
GDSDRLKPPPQASVTSNAFRKLSNSSPSVSPLILSSNLPMNDKTEHGNNDTKQNHDLTHR
KSPLDPAKLPPLSPGGTTSVKLKRAAPKEEAETANNLKPPEAKRKIQHVTWP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggatgtgggaggtcgcagctgcccggactcggagctgctgttgcacccggag
ctgctgtcccaagagttccttcttctcactctggagcagaagaacatagctgttgaaaat
gatgtaagaataaataaggacaaccttactgatctttatgtccagcatgcaatacctttg
cctcagagagatttgccaaagaatagatgggggaaaatgatggaaaagaaaagagaacaa
catgagatgaaacatgagacaaaaaggagtgccactgtagatgggttaaggaaaagaccc
ctcatcgtgtttgatggaagttcaacaagtacaagcatcaaagtgaaaaggacggaaaac
ggagatagcgaccgactgaagcctccccctcaggcaagcgttaccagtaatgcctttcga
aaattatcaaattcctctccaagtgtttcacccctaattttgtcttccaatttgcctatg
aatgataaaacggaacacggtaataatgacactaaacagaaccatgacttaacgcataga
aaaagtcccttggaccctgcgaagctgccacctttgtcccccggtggaaccacttcagtg
aagttaaagcgggctgctcctaaagaagaagcggagaccgcgaataacctgaagccccca
gaagcgaagaggaagatacaacatgttacatggccatga

DBGET integrated database retrieval system