KEGG   Loxodonta africana (African savanna elephant): 100660089
Entry
100660089         CDS       T04351                                 

Gene name
TAF2
Definition
(RefSeq) transcription initiation factor TFIID subunit 2
  KO
K03128  transcription initiation factor TFIID subunit 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100660089 (TAF2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100660089 (TAF2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lav03021]
    100660089 (TAF2)
   03036 Chromosome and associated proteins [BR:lav03036]
    100660089 (TAF2)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100660089 (TAF2)
Transcription machinery [BR:lav03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     100660089 (TAF2)
   Coactivators
    SAGA/TFTC/STAGA complex
     100660089 (TAF2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     100660089 (TAF2)
SSDB
Motif
Pfam: Peptidase_M1_N HEAT_2 Peptidase_M1
Other DBs
NCBI-GeneID: 100660089
NCBI-ProteinID: XP_003408212
Position
Unknown
AA seq 1202 aa
MPPTGLEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANL
NRIKLNSKQCRIYRVRVNDLEAAFIYNDPTLEVCHNESKQRNLNYFSNAYAAAVSAVDPD
AGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSIEGSMAERGAHVFSC
GYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTI
PTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYP
YSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFIS
RMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGG
GKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLA
STASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRK
RNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNK
KKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVV
AQQESILALEKFPTPASRLALTDILDQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMK
SLFTRMFCCKTCPNIVKTNNFLSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIK
YNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTVDNLSPDVRLILEEITRFLNME
KLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKV
DRSYEELQWLLNMIQTDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSG
TSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPEAVAGNQEA
ASNLSHPQLVGFQNTFSNSQDEEEIDMDTVHDSQAFISHHLNMLERPSTPGRIIGSLKIR
PASSRSALAPQHSSGCDGTPTTKPPWSMELARKGTGKEQSPLELSVHPAGAAPLSAFTKE
PAASRHGEHHHHHHHEHKKKKKKHKHKHKHKHKHDSRERDKEPLTYHSPAGGRSLRSPSL
SD
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgccgccgactggtttagagcccgccagaatgaacaggaagaaaggagacaaggggttt
gaaagcccaaggccatataaattaacccatcaggtggtctgcatcaacaacataaacttc
cagagaaaatctgttgtgggatttgtagaactgactatatttcccacagttgcaaacttg
aatagaatcaagttgaacagcaaacagtgcagaatataccgagtaagggtcaacgactta
gaggctgcctttatttataatgatccaaccttggaagtttgccacaatgaatcaaaacag
agaaatctcaattatttttccaatgcttacgcagcagcagttagtgctgtggatcccgat
gcgggaaatggagaactttgcattaaggttccctcagagctatggaaacatgtcgacgag
ttaaaggtcctgaagatacacatcaatttctctttggatcagccaaaaggaggtcttcat
tttgtggtacccagtatagagggaagcatggctgagagaggcgctcatgttttctcctgt
gggtatcaaaattccacaaggttttggttcccgtgtgttgattcatactctgaattatgt
acatggaaattagaatttaccgtagatgctgcaatggtggctgtttccaatggcgatttg
gtggagacagtgtatactcatgatatgaggaagaagaccttccattacatgcttaccatt
ccaacagcagcatcaaacatctccttggccattggaccttttgaaatacttgtagatcca
tatatgcatgaggttactcatttttgtttaccccagcttcttccattgcttaaacatacc
acgtcgtatcttcatgaagtctttgagttttatgaggaaattcttacatgtcgatacccg
tactcttgttttaaaactgtattcatcgatgaggcttacgttgaagtggctgcctatgct
tccatgagcatttttagcacaaatcttttacacagtgccatgattatagatgagacacct
ttgactagaaggtgtttagcccagtccttggcccagcagttttttggatgtttcatatct
agaatgtcttggtctgatgaatgggttctaaaaggaatttcaggctatatttatggactt
tggatgaaaaaaacttttggtgttaatgagtaccgccattggattaaagaggaactagac
aaaatagtggcatatgaattgaagactggtggagttttactacaccccatttttggtggc
gggaaggagaaggataatccagcatcacatctacacttttcaataaagcatccacatacg
ctatcctgggaatattacaccatgttccagtgtaaagctcaccttgtgatgagactgatt
gaaaataggatcagtatggaatttatgttacaagttttcaataaactgctaagtctggct
agtactgcttcatctcagaagttccagtcacatatgtggagtcagatgttggtttccaca
tctgggtttttgaaatccatctccaatgtttctggcaaagacatccagcctttaataaag
cagtgggtagaccagagtggagtggtaaaattttatggaagttttgcatttaatagaaaa
cgaaatgtcttggaattggaaataaaacaagattatacatctcctggaactcagaaatat
gtggggccacttaaagtgacagtgcaagagttagatggatccttcaatcatacattgcaa
attgaagaaaacagccttaaacatgatataccctgccattccaaaagcagaagaaataag
aagaaaaaaattccactgatgaatggagaagaagtcgacatggatctttctgcaatggat
gctgattccccgttgctgtggataaggatagacccagatatgtcagtactgaggaaggta
gaatttgaacaggcagattttatgtggcagtaccagctccgctatgagagggatgttgtg
gcacagcaagaatccatcttagccttggaaaagttccctactccagcatctcggcttgca
ctcactgacatattagaccaagagcagtgtttctaccgagtaagaatgtcggcttgcttc
tgccttgcaaagattgcaaattcaatggtgagcacgtggacaggaccaccagctatgaag
tcactcttcactagaatgttttgttgtaaaacttgtccaaacattgtgaaaacaaacaac
tttttgagctttcaaagttattttctgcagaagactatgccagtagcaatggctttattg
agagatgttcataacctctgtcccaaagaagtcttaacatttattttagacttaatcaag
tataatgataacagaaaaaataagttttcagataactattatcgtgcagaaatgattgat
gcccttgccaactccgtgacacctgcagttagtgtgaataatgaagttcgcaccgtggac
aacttgagtcctgatgtgcgactcattcttgaagaaatcaccaggtttttgaatatggaa
aaacttcttccaagctatagacataccatcactgtcagttgtttgagagccatacgggtg
cttcagaagaatggacatgtgccaagtgatccagctctttttaagtcttatgctgagtat
ggccattttgtagacattaggatagcagctttggaagcagttgttgattatactaaagtg
gacaggagttacgaagaactacagtggttacttaatatgattcagactgaccctgtaccc
tatgtaaggcataagattttaaacatgttgactaagaatccaccctttactaagaacatg
gagtctcccttatgcaatgaagcactggtagatcagctttggaaacttatgaactctggt
acttcacatgactggaggttacggtgtggcgctgtggacctgtacttcacactttttggc
ctcagtagaccttcctgtttacctttaccagaacttgggttggttcttaatctgaaggag
aaaaaagctgtgttgaatcctaccataattccagaggcagtagcaggcaaccaagaagct
gcgagtaatctaagccacccacagctagttggatttcagaacaccttctcaaattcccaa
gacgaggaggaaattgatatggatactgttcatgatagccaggctttcatttctcatcat
ttgaacatgctggaaaggccctcaactccaggtaggattattggctctctaaaaattcgg
ccagctagttcccggtcggctttagcaccccagcactcatcaggctgcgatggcacaccc
accacgaaacccccatggagtatggagcttgcacgtaaaggaacaggtaaggagcagtcc
cctttggagctgagtgtgcatccggcaggggcagctccgctctcagcgttcacaaaggag
ccggccgcctccagacacggcgagcaccaccaccaccaccaccacgagcacaagaagaag
aagaagaagcacaagcacaagcacaagcacaaacacaagcacgacagcagggagagggac
aaggagcctctcacctaccacagccccgccggcggcaggtccctacgttccccttccctc
tccgactga

DBGET integrated database retrieval system