KEGG   Loxodonta africana (African savanna elephant): 100660332Help
Entry
100660332         CDS       T04351                                 

Gene name
CACNA1I
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04713  Circadian entrainment
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04929  GnRH secretion
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100660332 (CACNA1I)
   04020 Calcium signaling pathway
    100660332 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100660332 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    100660332 (CACNA1I)
   04927 Cortisol synthesis and secretion
    100660332 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100660332 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100660332 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100660332 (CACNA1I)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100660332 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel Mlo
Motif
Other DBs
NCBI-GeneID: 100660332
NCBI-ProteinID: XP_023415750
Position
Unknown
AA seq 1790 aa AA seqDB search
MPPQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIV
GQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILG
MHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASL
YFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNMEEFDKLQEGLDSGGG
KQASTGHPGGQDPSGDPGGERAQHLASPSRPGSGEVHVVGSKREDFLVEDPKLCPAPMTP
NGHLDPSLPLGGHLGPTGGMAPTPRLSLQRDPVLVALGSRKSSVMSLGRMSYDQRSLGLM
GRDRLPVGTSCPNRGSVCGALTGAPASSQSSSRSSYYGPWGRSGTWASRRSSWNSLKHKP
PSAEHESLLSAERGGGARACEGARDEGPPRAAPLHAPHAHHAHRGPHVAHRHRHHRRTLS
LDTRDSVDLAELGPAGGAHPRTAWRAAAPAPGHEDCNGRMPSIAKDVFTKMNDRGDREED
EEEIDYVSVGRAWGRDQKAGQEISGRGPRGRLEWEGSEGRGIRGVALGWSGGSGLAGRVS
GRDSVPTVRWMPRVGGGRKLWAALTHPALSSPRQTLCFRVRKMIDAYKPEWCQVREDWSV
YLFSPENRFRVLCQTIIAHKLFDYVVLGFIFLNCITIALERPQIEAGSTERIFLTVSNYI
FTAIFVGEMTLKVVSLGLYFGEEAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGV
LRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKG
KFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGL
DAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRRE
EKRLRRLEKKRRKAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYN
QPTSLEIALKYCNYLFTTVFVLEAVLKLVAFGLRRFFKDRXRDLPDLPLCYFQVMGITLE
EIEINAPLPINPTIIRIMRFLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLL
FFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLR
DCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAE
IELEIAHSLGPSLGPGLRPPTSSPGAPSHGPGGAGGGGDPEGHLSQRCYSPAQENLWLDS
VSLIIKDSLEGELTIIDNLSGSVFHHYSSTASCEKCHHDKQEVQLAETEAFSLNSDRSSS
ILLGDGLSLEDLTAYPPGPKDGTGEPDLPEPVRVGDLGECVCPLSNTAVSSGPENYLCEV
EAIPFNPVRSWLKHESGQAAPPNPFSLEASSPLLPMPAEFFHPAVSAGQKGQEKVAGPGT
LPKIALQGSWASLRSPSVNCTLLRQATESDTSLDASHSSSVGSLQTTLEDSLTLSDSPRR
ALGPPMPALGPRASLSPAARRRLSLRGLRAHQRSHSSGGSTSPGCTHHDSMDPSDEEGGR
AGAGGGGAGSEHSETLSSLSLTSLFCPPPPPPPPGLRPARKFSSTSSLAAGPGRPRAASG
LPQGLPRSPSWAADRSKDPPGQAQQGHRPGPLGSPSRSPPPGELGELEAGFAATKRKRWR
GPWGQAGRHRLPAPSHFFLPQEPGSRQQYFVPHLGIMQGPASRQAAERGD
NT seq 5373 nt NT seq  +upstreamnt  +downstreamnt
atgcccccacagcccgaggagctgaccaacatcctggagatctgcaacgtggtcttcacg
agcatgttcgccctggagatgatcctgaagctggctgccttcgggctcttcgactacctg
cgcaacccctacaacatcttcgacagcatcattgtcatcatcagcatctgggagatagtg
gggcaggcagacggcggcctgtcggtgctgcggaccttccggctgctgcgggtgctgaag
ctggtgcgcttcatgcccgcgctgcggcgccagctggtggtgctcatgaagaccatggac
aatgtggccaccttctgcatgctgcttatgctcttcatcttcatcttcagtatccttggg
atgcacatctttggctgcaaattcagcctccgcacggacacaggtgacacagtccccgac
aggaagaactttgactccttgctgtgggccattgtaacggtgttccagatcctcacccag
gaggactggaatgttgtcctctataacggcatggcctccacctccccgtgggcctccctc
tactttgtcgccctcatgaccttcggcaactacgtgctcttcaatctgctggtggccatc
ctggtggagggcttccaggcagagggtgacgccaatcgctcctactcagatgaggaccaa
agctcatccaacatggaggagtttgacaagctccaggagggcctggacagcgggggaggt
aagcaggcctccactggtcacccagggggtcaggacccttccggggatccaggtggggaa
agggcacagcacctggcttccccctcaaggccaggcagtggggaggtgcatgtggtgggg
tccaagcgggaagacttcctggtggaggaccccaagctctgcccagcccccatgaccccc
aatgggcacctggaccccagtctcccactgggtggccatctgggccccactgggggcatg
gcccccaccccccgcctctcactgcagcgggaccctgtgctggtggctctgggctcccgc
aagagcagcgtcatgtcactggggaggatgagctatgaccagcgctccctgggcctcatg
gggcgggaccggctgccagtgggcacctcttgtccgaaccgtgggagcgtgtgtggggcc
ctgacgggagccccggcctcctcccagtccagctcccggagctcctactacgggccgtgg
ggccgcagcgggacctgggccagccgccgctccagctggaacagcctcaagcacaagcca
ccgtcggccgagcacgagtccttgctctcggccgagcggggtggcggcgcccgggcctgt
gagggcgcccgtgacgaggggccgccgcgagccgccccgctgcacgccccgcacgcgcac
cacgcgcaccgtggcccgcatgtggcgcaccgccaccgccaccaccgccggacgctctcc
ctcgacaccagggactcggtggacctggccgagctggggcccgcggggggcgcccacccc
cggacagcctggagggcggcggccccggccccggggcacgaggactgcaatggcaggatg
cccagcatcgccaaggacgtcttcaccaagatgaatgaccgcggggatcgcgaggaggat
gaggaggagatagactacgtgagtgtgggcagggcctgggggcgggaccagaaggctggc
caagaaattagtgggcggggccccaggggcaggctggagtgggagggctctgaggggcgt
ggcattaggggcgtggcccttgggtggagtggagggtctggacttgctggaagagtgtcg
ggacgcgattcagtgcctacagttcgttggatgccccgagtgggcggaggtaggaagctc
tgggcagcgctgacccaccctgccctgtcctcccctcgccagactctgtgcttccgggtc
cgaaaaatgatcgacgcttacaagcccgaatggtgccaggtcagagaggactggtccgtt
tatctcttctcccctgagaacaggttccgggtcctatgccagaccatcatcgcccacaag
ctctttgactatgtcgtcctgggcttcatcttcctcaactgtatcaccatcgccctggag
cggcctcagatcgaggcgggcagcacagaacgcatcttcctcactgtgtccaactacatc
ttcacagccatctttgtgggcgagatgacactgaaggtggtctctctcggcctgtacttt
ggcgaagaggcgtacctgcgcagcagctggaacgtgctggatggcttcctcgtcttcgtg
tcgatcatcgacatcgtggtgtctgtggcctcggccgggggagccaagatcctgggggtt
ctccgggtccttcggctcctgcgcaccctacgccccctacgggtcatcagccgggcaccc
ggactgaagctggtggtggagaccctcatctcctctctcaagcccattggcaacattgtc
ctcatctgctgtgccttcttcatcatcttcggcatcttgggggtgcagctcttcaagggc
aagttctaccactgcctgggtgtggacacccgcaacatcaccaaccgctctgactgcatg
gccgccaactaccgctgggtgcatcacaaatacaactttgacaacttgggtcaggccctg
atgtccctctttgtcctggcctccaaggacggctgggtgaacatcatgtacaatggactg
gacgctgttgctgtggaccagcagcccgtgaccaaccacaacccgtggatgctgctgtac
ttcatctccttcctgctcatcgtcagcttcttcgtgctcaacatgtttgtgggcgtcgtc
gtggagaacttccacaagtgccggcagcaccaggaggccgaggaggcgcggcggcgtgag
gagaagcggctgcggcgccttgaaaagaagcgccggaaggcccaacggctaccttactat
gctacctactgcccgacccggctgctcatccactctatgtgcaccagccactacctggac
atcttcatcaccttcatcatctgcctcaacgtggtcaccatgtccctggagcactacaac
cagcccacgtccctggagatagccctcaagtactgcaactacctgttcaccactgtgttt
gtgctggaggctgtgctgaagctggtggcatttggcctgaggcggttctttaaggaccgg
taacgagatctaccggacctgccattgtgctactttcaagtgatgggcatcacgctggag
gagatcgagatcaatgcaccattgcccatcaaccccaccatcattcgcatcatgcggttt
ttgcgcatcgcccgggtgctgaagctgttgaagatggccacaggcatgcgggctctgctg
gacacagtggtgcaggctctgccccaggtgggcaacctgggtctcctgttcatgctgctg
ttcttcatctatgccgccctgggtgtggagctctttgggaagctggtctgcaatgacgag
aacccatgtgagggcatgagccggcacgccaccttcgagaacttcggcatggccttcctc
acgctcttccaggtctccaccggcgacaactggaacgggatcatgaaggacacgcttcgg
gactgcacacacgacgaacgtagctgcctgagcagcctgcagttcgtgtcgccgctgtac
ttcgtcagcttcgtgctcactgcccagttcgtgctcatcaacgtggtggtggccgtgctc
atgaaacacctggatgacagcaacaaagaggcccaggaggacgccgagatggatgccgag
atcgagctcgagatagcccacagcctgggccctagcctgggccctggcctgcggccgccc
accagctccccaggggcacccagccatgggccaggtggggcaggtggtgggggcgacccc
gagggccacctgagccagcgctgctactctccagcccaggagaacttgtggctggacagc
gtctctttaatcatcaaggactccttggagggggagctgaccatcatcgacaacctgtct
ggctctgtcttccaccactactcctctaccgccagctgcgagaagtgtcaccatgacaag
caagaggtacagctggctgagacagaggccttctccctgaactctgaccggtcctcgtcc
atcctgctgggtgatggcctgagtctcgaggacctcacagcctacccgcctggccccaaa
gatggcacgggtgagccagacctgcctgagcccgtccgtgtgggggacctgggcgaatgc
gtctgccccttgtccaatacggctgtctcgtcaggcccagagaactacctgtgcgaggtg
gaggcgatcccattcaaccctgtccggtcctggctgaaacatgagagtggccaagcagcg
ccccccaaccccttctccctggaggcgtccagcccactcctgcccatgcctgctgagttc
ttccacccagctgtgtccgctggccagaaagggcaggagaaggtcgccggccctgggacc
ctcccaaagatcgctctgcagggctcctgggcctccctgcggtccccgagcgtcaactgc
acccttctccggcaggccacagagagtgacacgtcgctggatgccagccacagcagctca
gtgggcagcctgcagaccacgctggaggacagcctgaccttgagcgacagtccccggcgt
gctctggggccgcccatgcctgcactgggcccccgggccagcctgtcgcccgctgcccgc
cgccgcctcagcctgcgcgggctccgggcacaccagcgcagccacagcagtgggggctcc
accagccctggctgcacccaccacgactccatggacccttcagacgaggagggaggccgg
gccggtgcgggcggtgggggcgcgggcagcgagcactcggagaccctcagcagcctctcg
ctgacctccctcttctgcccgccgcccccaccaccgccccccggtctcaggccggccagg
aagttcagcagcaccagcagcctggccgctggccctggccgccctcgcgccgcctcgggc
ctgccccaaggcctgccccggagcccctcgtgggctgcagaccgcagcaaggacccaccg
ggccaggcccagcagggccataggcctggcccccttggaagcccgagccgcagcccaccc
ccgggggagctgggggagctggaggcagggtttgctgcaaccaagaggaagagatggagg
gggccatggggccaagccggacgccaccgcctgcccgccccgtctcacttctttttacct
caggagccagggagcagacagcaatactttgtcccacacctgggaattatgcaggggcca
gccagccgccaggccgccgagaggggagattga

DBGET integrated database retrieval system