KEGG   Loxodonta africana (African savanna elephant): 100660638Help
Entry
100660638         CDS       T04351                                 

Gene name
ATG5
Definition
(RefSeq) autophagy protein 5 isoform X4
  KO
K08339  autophagy-related protein 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04136  Autophagy - other
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04216  Ferroptosis
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100660638 (ATG5)
   04136 Autophagy - other
    100660638 (ATG5)
   04137 Mitophagy - animal
    100660638 (ATG5)
  09143 Cell growth and death
   04216 Ferroptosis
    100660638 (ATG5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100660638 (ATG5)
   04622 RIG-I-like receptor signaling pathway
    100660638 (ATG5)
  09149 Aging
   04211 Longevity regulating pathway
    100660638 (ATG5)
   04213 Longevity regulating pathway - multiple species
    100660638 (ATG5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100660638 (ATG5)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100660638 (ATG5)
Membrane trafficking [BR:lav04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    100660638 (ATG5)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100660638 (ATG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG5
Motif
Other DBs
NCBI-GeneID: 100660638
NCBI-ProteinID: XP_003404364
Position
Unknown
AA seq 275 aa AA seqDB search
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPERDLLHCPSKDA
IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAVSPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagatgtgtggtttggacgaattccaacttgcttc
acactgtatcaggatgagataactgaaagggaagcagaaccatactatttgcttttgccg
agagtaagttatttgacgttggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagacattagtgagatatggtttgaatatgaaggcacaccactgaaatggcat
tatccaattggtttgctatttgatcttcttgcatcaagttcagctcttccttggaacatc
acagtacattttaagagttttccagaaagggatcttctgcactgtccatctaaagatgca
attgaagctcattttatgtcttgtatgaaagaagctgatgctttaaagcataaaagtcaa
gtaataaatgaaatgcagaaaaaagatcacaagcagctctggatgggattacaaaatgac
agatttgaccagttttgggccatcaatcggaaactcatggagtatcctgcagaagaaaat
ggatttcgttacatcccttttagaatatatcagacaacaactgaacgacctttcattcag
aagctgtttcgtcctgtggctgcagatggacagttgcatacattaggagatctccttaaa
gaagtttgtccgtctgcagtttctcctgaagatggggaaaagaagaatcaagtaatgatt
catggaattgagccaatgctggaaacacctctgcagtggttgagtgaacatctgagctac
ccggataattttcttcatattagtatcatcccacaaccaacagattaa

DBGET integrated database retrieval system