KEGG   Loxodonta africana (African savanna elephant): 100661164Help
Entry
100661164         CDS       T04351                                 

Gene name
MTMR4
Definition
(RefSeq) myotubularin-related protein 4 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav04070  Phosphatidylinositol signaling system
lav04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100661164 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100661164 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100661164 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100661164 (MTMR4)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100661164 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     100661164 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     100661164 (MTMR4)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100661164 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3 EspF
Motif
Other DBs
NCBI-GeneID: 100661164
NCBI-ProteinID: XP_003414424
Position
Unknown
AA seq 1210 aa AA seqDB search
MSLTARVSCSMLSCFGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLG
RAADALIAISNYRLHIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQ
CQEWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARM
GFDLQNVWRVSHINSNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRN
GAAIARCSQPEISWWGWRNADDEYLVTSIAKACALDPGTRATGSSSNTGNSDASEACDTD
FDSSLTACSGVESSAAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANI
HAIRNSFQYLRAVCSQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVH
CSDGWDRTPQIVALAKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNEQ
CPVFLQWLDSVHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKR
TCSVWALLRAGNKNFHNFLYTPNSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDL
YLSPVTQSQEFSGRSLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEVRGGLEA
WHSNPEGSETTFVESGAGGPQPTVGEIGLPPPPSSNQKDYLSNKPFKNHKSCSPSYKLLN
TAVPQEVKSNTSDPEIKVLEESKIPAPDPPAQDELSRTLDGVGEEPCEHYPEKDAVSVLS
KVIFSKCDGICNFPESSQNSLTGAPQQIQLDSMLGVPAGCVSDPSLDILGSPLSAACQIP
PDSSPGFLSQNPPVSVASISHQEHPSSVPNLIHGEEDAGKRGTSRNGQLPENPRFGKMPL
ELVRKTISQSQISEFSFLGSNWDSFQGMVTSFPSGETAPRRLLSYGCCSKKSSSKQMRAT
GSCSGGQWAQREGMKSPVCSSHSSGHCTGPGGKNRMWLSGHPKQVSSTKPVPLSCPSPVP
PLYLDDDGLPFPTDVIQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMD
YEDDFTCLKESDGSDTEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDC
EFWLAKRRHHCRNCGNVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQH
LKKPIATASS
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaccgcccgcgtctcctgctccatgctcagctgtttcggtgaggaggggccc
cccagcctggagtacatccaagccaaggatctgttccctcccaaggaactagtgaaggag
gaggaaaatctgcaggtgcccttcacagtgctacagggtgagggagtggagttcctgggc
cgggcagctgatgccctcattgccatctccaactatcggctacatatcaagttcaaggac
tctgtcatcaacgtccccctccggatgattgacagtgtggagagtcgtgatatgttccag
ttgcacattgcctgcaaggactccaaagtggtgaggtgccacttctccactttcaagcag
tgccaagagtggctctcgcggctaagccgggccacagcaagacctgccaaacctgaggac
ctctttgcctttgcctaccatgcctggtgcctggggctgactgaggaggaccagcatacc
cacctgtgtcagccaggagaacacatacgatgtcggcaggaggcagagcttgcgaggatg
ggctttgacctgcagaatgtctggagagtctctcacatcaacagcaattacaaattatgt
cccagttaccctcagaagctgctggttcccgtgtggatcacagataaagagctggagaac
gtggcttccttccgctcctggaagcggatccctgtggttgtgtataggcacctgcgcaac
ggggccgccattgcccgctgcagccagcccgagatcagctggtggggctggcgtaatgct
gatgatgaatacctggtcacgtccattgccaaagcctgtgccctggacccagggactagg
gccactgggagctcgtccaacaccgggaacagtgatgcgagtgaggcgtgtgacactgac
tttgattcctccctgactgcatgctctggggtggagagctcagcggctccccagaagctg
ctgatcctggatgctcgctcctacacagcggcagtggccaaccgggccaagggtggaggt
tgtgaatgcgaagagtactatcccaactgtgaggttgtattcatgggtatggccaacatc
catgccatccgaaatagcttccagtacctgcgggctgtgtgtagccagatgccagatccc
agcaactggctgtcggcactggagagcaccaaatggctacagcacttgtcggtgatgcta
aaggcagctgtgctggtggctaatacagtagaccgggaaggccgacctgtgctggtgcac
tgttcagatggctgggaccggacgccacagattgtagccctggccaaaatactgctggac
ccgtattacaggacattggagggcttccaagtgttagtggagtctgactggctggatttt
gggcacaagtttggagatcgctgtggccaccaggagaatgcagaggaccaaaatgaacag
tgtcctgtgttcctccagtggctcgattctgttcatcagttgctcaagcagttcccctgc
ctgtttgagtttaacgaagcattcctggtaaaactggttcagcacacgtactcctgcctc
tatggcacgttcctggccaacaacccctgtgagcgagagaagcgcaacatctataagcgg
acctgctctgtgtgggctctcctgcgagctggcaataagaacttccataacttcctctac
acacccaattcagacatggtcctgcatcctgtgtgtcatgttcgggcccttcacctctgg
acagctgtttatctgccagcttcatctccatgcacacttggggaggaaaacatggatctt
tacctttccccggtgactcagagccaggagttctctggccgttctctagacagattgcct
aaaaccaggtccatggatgatcttctttctgcctgtgacaccagcagccccttgactcgc
acatccagtgaccctaacctgaataaccactgtcaggaggtcagaggaggcctggaggcc
tggcacagcaatcccgaaggatcagagacaacctttgtggaatctggggcaggaggtcct
cagccaactgtaggagaaataggtcttcctccccctccatccagcaaccagaaagactac
ttgagcaataagcctttcaagaaccacaaaagctgttctccaagttacaaactgcttaat
actgcagtgccacaggaagtgaagagcaacacctctgatcctgagatcaaagtcctggaa
gagtctaagataccagctccagaccctcctgcccaggatgagctgagtaggactttagat
ggcgtaggggaggagccatgtgaacattacccagaaaaagatgctgttagtgtactttct
aaggtcattttcagcaagtgtgatggaatttgcaattttcctgagtcttcccagaactct
cttacaggcgccccccaacagatccagctagactccatgctcggtgtgcccgccggttgt
gtttcagatcccagtctggacatccttggcagcccactgagtgctgcctgccagatccct
ccagactcaagccctggtttccttagccaaaatcccccagtgtctgtggcaagtatctcc
caccaggaacatcccagttctgtgccgaatttgattcatggggaggaagacgctggcaaa
agagggactagtaggaatgggcagttaccggaaaatcctcgctttggaaaaatgcctttg
gaattggtccgcaagacaatttctcagagccagatcagtgagttctcttttctagggtcc
aactgggacagcttccaaggtatggtgacttcattccctagtggggagactgcccctcgg
cggctgctttcgtatggctgttgtagcaagaagtcaagcagcaagcagatgcgggcaacg
gggtcctgctctgggggccagtgggcccagcgagaaggcatgaagtcacctgtctgttct
agtcattccagtggacactgtactggcccaggaggaaaaaaccggatgtggttgtctggt
cacccaaagcaggtctccagtacaaagcctgttccactgagctgcccttctccagtgcct
cctctatacctggatgacgatggactcccctttcccacggatgtgatccagcatagatta
cgacaaattgaagcagggtacaagcaagaggtggaacagctacgccgacaggtgcgtgag
cttcagatgaggctggatatccgtcactgctgtgcccctccagcagagccccccatggac
tatgaggatgattttacgtgtttgaaggagtcagatggcagtgacacagaggattttggc
tctgatcacagtgaagactgcctttcagaagcaagctgggaacctgttgataagaaagaa
actgaggtgactcgctgggttccagaccatatggcatcacattgctataactgtgactgt
gaattctggttggccaaacgaagacaccactgcagaaattgtgggaatgtattttgtgct
ggatgctgccacctgaagctgcccattcctgatcaacaactctatgacccagttctcgtc
tgtaactcatgttacgaacacatccaagtatctcgtgccagggaactcatgagccaacat
ctgaagaaacccattgctaccgcttccagctga

DBGET integrated database retrieval system