KEGG   Loxodonta africana (African savanna elephant): 100661711Help
Entry
100661711         CDS       T04351                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00010  Glycolysis / Gluconeogenesis
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100661711 (MINPP1)
   00562 Inositol phosphate metabolism
    100661711 (MINPP1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100661711 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100661711 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 100661711
NCBI-ProteinID: XP_003409300
UniProt: G3T812
Position
Unknown
AA seq 487 aa AA seqDB search
MLRGPCGLLRAQVAPAAVLAAALLSSLGRCSFLESGDPVASALSPYFGTKTRYEDVNPGL
LPNPEAPRRDPELLEGTCTPVQLVAVIRHGTRYPTAKQIRKLRHLHGLLQARGPGGGRPR
GTGGRDVGAALADRPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFCPENFGRLRLV
TSSKHRCVDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRINDKLMRFFDHCKKFLTEVE
SNATALYHVEAFKTGPEMQSILKKVAATLEVPVNDLNADLIQVAFFTCSFDLAIKDIKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCILFEDIFQHLDKAVEQKQRSQPI
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQVHRKFRSGHIVPYASNLIFLLY
HCENAKTAKEEFQVQMLLNEKVLPFAYSQETVSLYEDLKNHYKDILRSCHASNECELPKV
NSTSDEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcggcccgtgcggcctcctcagggcccaagtagcgcccgccgcggtcctggct
gcggcgctgctctcgtcgctggggcgctgctccttcctggagtcgggggaccccgtggcc
tcagcgcttagcccctacttcggcaccaagacccgctacgaagacgtcaaccccgggctg
cttccgaaccccgaggcaccccggagggacccggagctgctggaggggacgtgtacgcca
gttcagctggttgccgtcatccgccatggcacccgctacccgacggccaagcagatccgc
aagctgcggcacctgcatgggctgctgcaggcccgcgggccggggggtggcagacccaga
ggtaccggcggccgcgacgtgggcgctgcgctggccgacaggccgctgtggtacgcggac
tggatggacgggcagctggtggagaaagggcggcaggacatgcgacagctagcgctgcgc
ctggcctcgctcttcccagccctcttctgccccgagaatttcggccgcttgcggctggtc
accagctccaagcaccgctgcgtggacagcggcgccgcctttctgcagggactgtggcag
cactaccaccccggcctcccgccgcccgacgtcgcagacatggaatgtggacctccaagg
attaatgataaactaatgaggttctttgatcattgcaagaagtttttaactgaagtggaa
agtaatgctacggctctttaccatgtagaagccttcaaaactggaccagaaatgcagagc
attttaaaaaaagttgcagctactttagaagtgccagtaaatgatttaaatgcagattta
attcaggtagcttttttcacctgttcatttgacctggcaattaaagacattaagtctcct
tggtgcgatgtttttgacatagatgatgcaaaggttttagagtatttaaatgatctgaaa
cagtattggaaaagaggatatggttatactattaatagtcgatccagctgcatcctgttt
gaggatatctttcagcatttggacaaagcagttgagcagaaacaaaggtctcagccaatt
tcttctccagtcatcctccagtttggtcatgcagagacccttcttccactgctttctctt
atgggctacttcaaagacaaggagcccctaactgcttacaattacaaggaacaagtacat
cggaagttccgaagtggtcatattgtaccctatgcctcgaacctgatatttctgctttac
cattgtgaaaatgctaagactgctaaggaagaattccaagtgcagatgttattgaatgaa
aaggtgttaccctttgcttactcacaagaaaccgtttctttgtatgaggatctgaagaac
cattataaggacatacttcggagttgtcatgccagtaatgaatgtgaattaccaaaggtg
aacagcacatctgatgagctatga

DBGET integrated database retrieval system