KEGG   Loxodonta africana (African savanna elephant): 100663202
Entry
100663202         CDS       T04351                                 

Gene name
LTA4H
Definition
(RefSeq) leukotriene A-4 hydrolase isoform X2
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00590  Arachidonic acid metabolism
lav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100663202 (LTA4H)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100663202 (LTA4H)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     100663202 (LTA4H)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100663202 (LTA4H)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N E1_DerP2_DerF2
Other DBs
NCBI-GeneID: 100663202
NCBI-ProteinID: XP_003405319
UniProt: G3T4F3
Position
Unknown
AA seq 611 aa
MPEVVDTCSFASPAFVCRTKHLHLRCSVDFTRRTLTGTVALTIESQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEIFLPIPLSKNQEVIIEISFETSPKSTALQWLT
PEQTSGKEYPYLFSQCQAIHCRAVLPCQDTPSVKLTYSAEVSVPKELVALMSAIRDGEAP
DPKDSSRKIYRFNQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLQIAEDLGGPYVWGQYDLLVLPPSFPFGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFHALGGWGELQNTVKTFGDT
GPFTKLVVDLKDVDPDVAYSLVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVKKFSYKSI
TTDDWKDFLYSHFKDKADILNQVDWNAWLYSPGLPPVKPNYDMTLTNACIALSQRWITVS
SNXFNSFSAADLKDLSSHQLNEFLAQLIQKAPLPLGHVKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHNLAICAYQQHKASMHPVT
AMLVGKDLKVD
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgccggaggtagtggatacgtgctcatttgcctctccggcttttgtctgccggaccaag
cacctgcatctgcgctgcagcgtcgactttactcgccggacgctaaccgggaccgtcgcg
ctcactatcgagtcgcaggaggacaatctgcgcagcctggttttggatacgaaggacctt
acaatagaaaaagtggtgatcaacggacaagaagtcaaatatgctcttggagaaagacaa
agttacaaaggatcaccaatggaaatctttctgcccattcctctgagcaaaaatcaagaa
gtcattatagaaatttcttttgagacgtctccaaaatctactgctcttcaatggctcact
cctgagcagacttcggggaaggaatacccgtatctctttagtcagtgccaggccatccac
tgcagggcagttcttccttgccaagatactccttctgtgaaattaacctacagtgcagag
gtgtctgtccctaaagaactggtggcacttatgagtgctattcgtgatggagaagcacct
gatccaaaagattcaagcaggaaaatctatagattcaaccagaaagttccgataccctgc
tacttgattgctttagttgtcggagctttagaaagcaggcaaattggcccaagaacattg
gtatggtctgagaaggagcaggtcgaaaagtctgcttatgaattttctgagactgaatcg
atgcttcaaattgcagaagatctgggaggaccatatgtatggggacagtatgacctgttg
gtccttccaccctccttcccttttggcggtatggagaatccttgccttacttttgtaact
cctactctactggcaggtgacaagtcactctccaatgttattgcacatgaaatatctcat
agttggacaggaaatctagtgaccaacaaaacttgggatcacttttggttaaatgaagga
catactgtgtacttggaacgccacatttgtggacgattgtttggtgaaaagttcagacat
tttcatgctctgggaggatggggagaactacagaatacagtaaagacttttggggataca
ggacctttcaccaaactcgtggttgatctgaaggatgttgaccctgacgtagcatattct
ttggttccgtatgagaagggctttgctttactcttttacctcgaacagcttctcggagga
ccagagatattcctaggattcttaaaggcttatgttaagaaattttcttacaagagcata
accactgatgactggaaggatttcctttattcccactttaaagataaggctgatatcctg
aatcaagttgattggaatgcctggctgtactctcctggactgcctcctgtaaaacccaat
tatgatatgactttgacaaatgcttgtattgctttaagtcaaagatggattactgtgagt
agtaatnnntttaattcattcagtgcagcagacctgaaagatctctcttctcatcagttg
aatgagtttctggcacagctgatccagaaagcacctcttccattggggcacgtaaagcga
atgcaagaggtgtacaacttcaatgccattaacaattctgaaatacgattcagatggtta
cggctctgcattcaatccaagtgggaggacgcaattcctttggctctgaaaatggcaact
gaacaaggaagaatgaagtttacacgacccttattcaaggatcttgctgcctttgacaaa
tcccacaatctagccatctgtgcttaccagcagcacaaagccagtatgcatcctgtgacg
gccatgctggtggggaaagacttaaaagtggattaa

DBGET integrated database retrieval system