KEGG   Loxodonta africana (African savanna elephant): 100663711Help
Entry
100663711         CDS       T04351                                 

Gene name
CDKL2
Definition
(RefSeq) cyclin-dependent kinase-like 2
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100663711 (CDKL2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100663711 (CDKL2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   100663711 (CDKL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase RIO1 Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 100663711
NCBI-ProteinID: XP_010592435
Position
Unknown
AA seq 565 aa AA seqDB search
MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRH
ENLVNLLEVCKKKKRWYLVFEFVDHSILDDLELFPNGLDYQIVQKYLFQIINGIGFCHSH
NIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYG
KAVDVWAIGCLVTEMLMGEPLFPGDSDIDQLYHIMTCLGNLIPRHQELFYKNPAFAGVRL
PEIKETEPLERRYPKLSEVVIDLAKKCLHIDPDRRPFCAELLHHDFFHVDGFAERFSQEL
KLKIQKDTRNISLSKKFQNRKKEKEKDDSLGGERKTLMVQDTNANPKIKDSKVFKIKASK
IDGEKVEEGIQASNVSYLHDSGTSHIKIVPSTSLRDCSNGSVDHTRNSGVAIPPLTHNLS
AVASRINSGLGTIPGVQSYRVDEKTKKYYIPFVKPSKHSPSGIFNINLTTSVAGEKRLLQ
ANKKRREKEGTKTDVRLPELNYKHLPELRALEDIAQNSRLVRKENKILSESQIPSLAAID
LHAPTVALHQVSGSSLPDASEADFP
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatgagaacctaggattggttggagaagggagctatggaatggtgatgaag
tgtaggaataaagatagtggaagaattgtggccatcaagaagttcttagaaagtgatgat
gacaaaatggttaaaaaaattgctatgcgagaaatcaagttactaaagcaactgaggcat
gaaaatctggtgaatctgttggaagtgtgtaagaaaaaaaaaagatggtacctagtcttt
gaatttgttgaccactcaattcttgatgacttggaactctttccaaatggcctagactac
caaatagttcaaaagtatttgtttcagattattaatggaattggattttgtcacagtcat
aatatcatacacagagatataaagccagaaaatatattagtctcccagtctggtgttgtc
aagttatgtgattttggatttgcccggacattggcagctcctggggaagtttatactgat
tacgtggcaacccgatggtacagagctccagaactattggttggtgatgtcaagtatggc
aaggctgttgatgtgtgggccattggttgtctggtaactgaaatgcttatgggggaaccc
ctgtttcctggagattctgatattgatcagctatatcatataatgacgtgtttgggtaat
ttaattccaagacatcaagagctattttataaaaatcctgcatttgctggagtaaggttg
cctgaaatcaaggaaactgaacctcttgaaagacgctaccccaaactctctgaagtagtg
atagatttagcaaagaaatgtttacatattgacccagacagaaggcccttctgtgctgag
ctcctgcatcatgatttctttcacgtggatggatttgctgagaggttttctcaggaacta
aagttaaaaatacagaaagatacgagaaatatttctttatctaaaaaattccaaaacagg
aagaaggaaaaggaaaaagatgactccttaggtggagaaagaaaaacacttatggtgcag
gataccaatgctaatcccaaaattaaggattctaaagtatttaaaataaaagcatcaaaa
attgatggagaaaaagttgaagaaggtattcaagcttcaaatgtcagctatctccatgac
agtgggacaagtcacatcaaaatagtgccttcaacaagcctcagagactgcagcaatggc
agtgtggatcacacaaggaattcaggcgtggccattcccccacttacacacaacctttct
gctgtggcttcccgtattaattctggactgggaactatcccaggagttcagagttacaga
gtggatgagaaaaccaagaagtattatatcccatttgttaagccaagtaaacattctcca
tcaggcatttttaatattaacctgaccacatcagtcgctggtgaaaagcgcctccttcag
gcaaataagaaaagaagggaaaaagaagggacaaagacagatgtccgtttacctgaacta
aattataagcatctccccgaactaagagccttggaagacatagctcaaaattcgaggcta
gtaaggaaagagaacaaaattctttcagaatctcaaattccgtctctggcagctattgac
ctccacgcccccactgttgcattacatcaggtatcagggtcttccctgccagatgcttca
gaggctgacttcccttga

DBGET integrated database retrieval system