KEGG   Loxodonta africana (African savanna elephant): 100663944
Entry
100663944         CDS       T04351                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100663944 (ERAP1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100663944 (ERAP1)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100663944 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100663944
NCBI-ProteinID: XP_023409575
Position
Unknown
AA seq 874 aa
MTSLFLQWPLATVSFLLFSLVTLFIVSAPSWCRSSDTTAPEASNGAPFPWNKVRLPEHVI
PVHYDLMIHANLTTLTFWGTTEIEITASQPTSTIILHSHRLQISKATLRKGAGERQSEDP
LRVLEYTPHEQIALLAPEPLLVGVLYTIVIEYAGNLSESFHGFYKSTYRTKEGEVRVLAS
TQFEPTAARMAFPCFDEPALKASFSVKIRREPRHLAISNMPLVKSVTIAKGLIEDHFDVT
VKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFESGAMENWGLTTYRESSLLFDAEKSSASSKLGITMIVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEYVSVRVTHPELKVEDYFLGKCFNAMEVDALNSSHPV
STPVENPAEIREIFDDVSYEKGSCILNMLRDYLGADTFKSGIVQYLQKYSYKNTKNEDLW
NSIASICPTGGTKGMDSFCSRGQHSSSSSHWRQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEHYMKRPDDAPETGYLWHVPLTFITSKSDSVHRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKRRHTTISSNDRASLINSAFQLVSIGKLPIEKALD
LTLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDE
GSVSERMLRSQLLLLACVRKYQPCVERAEGYFREWKESSGNLSLPNDVTLAVFAVGAQNT
EGWEFLYSKYQSSLSSTEKNQIEFALCTSQDKEKLQWTRTWLEEVKGFFSSLKENGSQLR
CVQQTIETIEENIRWMDKNFDKIRVWLQNENLGL
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgacatctctgttcctccagtggccacttgcaactgtgtcatttctgcttttctcactg
gtgactctcttcattgtgtcagctccttcatggtgccggagtagtgatactacagctcca
gaagctagtaatggggcaccatttccttggaataaagtgcgactcccagagcatgtcatc
ccagttcattatgatctcatgatccatgcaaaccttaccactctgactttctggggaact
acagagatagaaatcacagccagccagcccaccagtaccattatcctgcatagtcaccgc
ctgcaaatatctaaggcgaccctcaggaaaggggctggagagagacagtctgaagatccc
ctgagggtcctggaatacacgcctcatgagcaaatcgctcttctggctcccgagcccctc
cttgttggagttctgtacacgattgtcattgagtatgctggcaatctttctgagagtttc
catggcttttataaaagcacctatagaaccaaggaaggggaagtgagggtacttgcatca
acacagtttgaacctacggcagctcgaatggcctttccctgctttgatgaacctgccctg
aaagcgagtttctcagtcaagatcagaagggagccaagacacctggccatctccaatatg
cctttggtgaaatctgtgactattgccaaaggactcatagaagaccattttgacgtcacg
gtgaagatgagcacgtacctggtggccttcattatttcagattttaagtctgtcagcaag
atgaccaagagcggagtcaaggtttctgtatatgcagttccagacaagataaatcaagct
gattacgcactggacgccgcagtgactcttctggaattttatgaggattatttcagcatt
ccgtatcccttacccaaacaagatcttgctgctattcctgactttgaatccggtgcaatg
gaaaactggggactcacaacgtatagagagtcgtctttattgtttgatgcggaaaagtct
tctgcatcaagtaagcttggcatcacaatgattgtgtcccatgaacttgcccaccagtgg
tttgggaacctggtcaccatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggaatatgtgtctgtcagggtgacccatccagagctgaaagttgaagattat
ttccttggcaagtgttttaatgcaatggaagtagatgcattgaattcctcacaccctgtg
tccactcctgtggagaatcctgctgagattcgggaaatatttgatgatgtttcttatgaa
aagggatcttgtattctgaatatgttaagagattatcttggtgccgacacatttaaaagt
ggcattgtacagtatctccagaagtatagctataaaaacacaaaaaatgaggacctgtgg
aatagtatcgcaagtatttgtcctacaggtggcacaaaagggatggatagcttttgttct
agaggtcagcattcatcttcgtcctcacactggcgtcaggaaggccttgatgtgaaaacc
atgatgaacacctggacgctgcagaagggctttcccctgataaccatcacagtgcgagga
aggaacgtacacatgaagcaagagcactatatgaagcgacctgacgatgccccagaaact
ggatacctgtggcatgttccactgaccttcattaccagcaaatcagactcggttcacaga
tttttgctcaagacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaacgtgggaatgaatggctattacattgtgcattatgaggatgatggatgggattct
ttgactggcctcttaaaaagaagacacacaaccatcagcagtaatgatcgggccagtctc
attaacagcgcatttcagcttgtcagcattggaaagctacccattgaaaaagccttggat
ttaaccctgtacttgaaacatgaaacagaaattatgcctgtgttccaaggtttgaatgag
ctaattcctatgtataagttaatggagaaaagagatatgaatgaagtagaaactcagttc
aaggccttcctcatcaggctgctgagggacctcattgataagcagacgtggacagacgag
ggctctgtctctgaacgaatgctgcggagtcagctcctcctcctcgcttgtgtgcgcaag
taccagccatgtgtggagagggcagaaggctatttcagagagtggaaggaatccagtggg
aatttgagcttacccaatgacgtgaccttggcggtgtttgctgtgggggcccagaacact
gaaggctgggaatttctttatagtaaatatcagtcttctttgtccagtactgagaaaaac
caaattgaatttgccctctgtacgagccaagataaggaaaagcttcagtggacaagaacc
tggcttgaagaggtaaaaggattcttcagctctttgaaagaaaatggttctcagctccgt
tgtgtccaacaaacaattgaaactattgaggaaaacatacgttggatggataagaatttc
gataagatcagagtgtggttacaaaatgaaaaccttgggctgtaa

DBGET integrated database retrieval system