KEGG   Loxodonta africana (African savanna elephant): 100664229
Entry
100664229         CDS       T04351                                 

Gene name
ERAP2
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 2 isoform X1
  KO
K13723  endoplasmic reticulum aminopeptidase 2 [EC:3.4.11.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100664229 (ERAP2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100664229 (ERAP2)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100664229 (ERAP2)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Peptidase_MA_2
Other DBs
NCBI-GeneID: 100664229
NCBI-ProteinID: XP_010587887
Position
Unknown
AA seq 954 aa
MVNSHRKLIFRIYVGFYCSAILLLRICICSQLSMPSINQLSKDAETIPVATNGEPFPWHK
LRLPHLVIPLHYDLLVHPNLTSLDFTASEKIEILVREATQFIILHIKDIEIINATLHSEE
DLRYRKPGTKLNVLSYPAHQQIALLAPDELIADMRYYVAINFQAKLADGFKGFYKSTYRT
LGGETRIIAVTDFEPTQARAAFPCFDEPLFKANFTIKIRRESRHIALSNMPKVQTIELEG
GLLEDHFETTVKMSTYLVAYIVCDFNSVSGTTSSGVKVSIYASPDKGSQTYYALDSSLKL
LDFYENYFDISYPLPKLDLVAIPDFESGAMENWGLITYRETSLLFDPKTSSASDKMWVTK
VIAHELAHQWFGNLVTMEWWNDIWLNEGFATYMELISINATYPELQFDDYFLNVCFEAIA
KDALNSSRPISNPAETPTQIREMFDVVSYNKGACILNMLKDFLTEEKFREGIIHYLRKFS
YRNAKNDDLWASLSNSCSEGDFMSGGFCYSNSKMRSNTLSVLEKNVEIKEMMSTWTLQKG
IPLVVVNQEGHSLRLHQELFLKGVFREDPEWETLQGRYFWHIPLTYSMSSSNAIHRHILK
SKTDTLELPEKTSWLKFNVDSNGYYIVHYEGLGWDHLITQLNQNHTLLRPKDRIGLIHDA
FQLVSVGRLTLDKALDLIRYLPHETSSPALTEGLRHLELFYHMMDRRNISDVTENLKRYL
LRYFKPVIDKQSWSDEGLTCDRLLRSTVLKLACDLNHPPCIRKAAELFSWWLESSGKLNI
PTDVLKIVYSVGARTTEGWDYLLEQYGLSTSVAEKNKILYALSTSKHQEKLVKLIELGME
GKVIKTQDFASLLHAIARNPKGQQLAWNFVKENWTQLLKKFDLGSFAMRVIISGTTSHFS
SKDELQEVKLFFESLKAQGLHLDVFQIVLETINNNIKWLERNLNTLRTWLLVSI
NT seq 2865 nt   +upstreamnt  +downstreamnt
atggttaattcacacagaaaactaatatttcgtatttatgtaggattttattgctcagca
atcctcctgctcagaatatgtatttgttctcagctctcaatgccatctattaatcagctc
agtaaggatgctgagactatccctgtagccaccaatggggaaccatttccttggcacaag
ctaaggcttcctcacctggtcattcccctccactatgacctccttgtccacccaaatctc
acctccctggactttactgcatctgagaagattgagattttagtcagagaagccacccag
tttatcatcttgcacatcaaagacattgaaatcataaatgccacgcttcactcagaggaa
gatttgaggtacagaaaaccagggacaaaactgaatgttttgagttatcctgctcatcag
caaattgcactcctggctccggacgaacttattgctgacatgagatactatgtggctatt
aactttcaagccaagttagctgatggctttaaaggattttataaaagcacgtacagaact
cttggtggtgaaacaagaataattgcagtaacggatttcgagccaacccaggcacgtgcg
gccttcccttgctttgatgaaccgttgttcaaagccaactttacaatcaagataagaaga
gagagcagacacattgctctatccaacatgccaaaggttcagacaattgaacttgaagga
ggcctcttagaagaccactttgaaacaactgtaaaaatgagtacatacctggtagcctat
attgtttgtgatttcaactctgtgagtggcacaacctcatcaggggtcaaggtctccatc
tatgcatccccagacaaagggagtcaaacatattatgctttggactcatcgctgaagctg
cttgatttttatgaaaactactttgatatcagctatccgttaccaaagctggacctagtt
gccattcctgactttgagtctggagccatggaaaattggggcctcatcacatatagagag
acgtcactgctctttgatcccaagacctcttctgcttctgacaaaatgtgggtcaccaaa
gtcatagcccatgaactggcacaccagtggtttggaaacctggttacaatggagtggtgg
aatgatatttggcttaacgagggttttgcaacatacatggagcttatctctattaatgct
acatatccggaactacaatttgatgattattttttgaatgtgtgttttgaagcaattgca
aaagacgcgttgaattcatcccgtcctatctccaatccagcggaaactcctactcaaata
cgggaaatgttcgatgtggtttcctataacaagggagcttgtattttgaatatgctcaag
gattttctgactgaggagaaattccgggaaggaataattcactacctaaggaagttcagt
tacagaaatgctaagaacgatgatttgtgggcaagtctgtcaaatagttgttcagaaggt
gattttatgtctggtggattttgctattccaattccaagatgagaagtaacacactcagc
gttttggagaagaatgtggaaatcaaagagatgatgagtacatggactctccagaaagga
atccccctcgtggtggttaaccaagaagggcattcactcagactgcaccaggagctcttc
ctgaagggagttttcagagaggaccctgaatgggagactctgcagggaaggtacttttgg
catatcccattgacctactccatgagttcctctaatgccattcacaggcacattctaaaa
tcaaagacagatactctagaattacctgaaaagactagttggttgaaattcaatgtggac
tcaaatggctactacatcgttcattatgaggggcttggatgggaccacctcattacacag
ttgaatcagaaccacacacttctcagacctaaggacagaatcggtctaattcatgatgca
tttcagctggttagcgtaggacggttgacccttgacaaagctctggacctgattcgctat
ctcccacatgaaacaagcagccctgcacttaccgaaggtctgagacacttagaattattt
taccacatgatggacagaaggaatatctcagatgtcactgaaaacctcaagcgttacctt
ctccgatattttaagccagtgattgacaagcaaagctggagtgatgagggcttgacctgc
gacaggctgcttcgctcaactgtcttgaagttggcctgtgacctgaaccatcctccttgc
atccggaaggcggctgaactcttctcttggtggttggagtccagtggaaaattaaacatc
ccaacagatgttttaaagattgtgtattctgtgggtgctcggacaacagaaggatgggat
tacctcttagagcaatatggactgtcaacgtcagttgctgaaaaaaacaaaattctgtat
gcgttgtcaaccagcaaacatcaggaaaagttagtgaagttaattgaactaggaatggaa
ggaaaggttatcaagacccaggactttgcatctcttcttcatgcgattgccagaaatcca
aaggggcagcaattagcctggaattttgtaaaagaaaattggactcaactccttaaaaaa
tttgacttgggttcgtttgccatgagagtgattatttctggtacaacgtctcacttttct
tccaaggatgagttgcaagaggtgaaactgttctttgaatcccttaaggcccaaggatta
cacctggatgtttttcaaattgttctggaaactataaataataatattaagtggctggag
aggaatcttaacactctgaggacttggctactggttagtatttaa

DBGET integrated database retrieval system