KEGG   Loxodonta africana (African savanna elephant): 100664328Help
Entry
100664328         CDS       T04351                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100664328 (HTR4)
   04024 cAMP signaling pathway
    100664328 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100664328 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100664328 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100664328 (HTR4)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100664328 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 100664328
NCBI-ProteinID: XP_010589976
Position
Unknown
AA seq 401 aa AA seqDB search
MGFLSVFQTFLQSFVSFCVTYSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRD
RQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTAS
IFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIT
DLIEKRKFNLNSNATYCIFMVNKPYAITCSVVAFYIPFFLMVLAYYRIYVTAKEHAHQIQ
MLQRAGAPSEGRPQPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFVDY
TVPGEVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTAPCS
TTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctctctgtgtttcagactttcctccaatcctttgtttcattttgtgtgact
tacagttccaaggagggttttggctcagtggagaaggtcgtgctgctcacgtttctgtca
gcggttatcttgatggccatcttggggaacctgctggtgatggtggctgtgtgcagggac
cggcagctaaggaagataaaaaccaattatttcattgtatctcttgcctttgcggacctg
ctggtttcggtgctggtgatgccctttggtgccatcgagctggttcaagacatctgggtt
tatggggagatgttttgcctcgtccggacatctctcgacgtcctgctgaccacagcttcg
atttttcacctgtgctgtatttcactggataggtattatgccatctgctgccagcctttg
gtctataggaacaagatgacccctctgcgcatcgcactaatgctgggaggctgctgggtc
atccccatgtttatctcttttctccctataatgcaaggttggaataacattggcataact
gatttgatagagaaaagaaagttcaacctgaactctaatgctacatactgtatcttcatg
gtcaacaagccctatgccatcacctgctctgtggtggccttctacatcccgttcttcctc
atggtgctggcctattatcgcatctatgtcacagctaaggagcatgcccaccagatccag
atgttgcaacgggcaggagccccatcagagggcagacctcagccagcagaccagcacagc
acacatcgcatgaggacagagaccaaagcagccaagaccctgtgcatcatcatgggttgc
ttctgtctttgctgggctccgttttttgtcaccaatattgtggatcctttcgtagactac
actgtccccggggaggtatggactgctttcctctggctcggctatattaactccgggttg
aacccctttctctacgccttcttgaataagtcttttagacgtgccttcctcatcatcctc
tgttgtgatgatgaacgctaccgaagaccttccattctgggccagactgccccctgttca
accacaaccattaacggatccacacatgtgctaagggatgcagtggagtgtggtggccag
tgggagagtcagtgccaccccccagcaacttctcctttggtggctgctcagcccagtgac
acttag

DBGET integrated database retrieval system