KEGG   Loxodonta africana (African savanna elephant): 100664517
Entry
100664517         CDS       T04351                                 

Gene name
LNPEP
Definition
(RefSeq) leucyl-cystinyl aminopeptidase
  KO
K01257  cystinyl aminopeptidase [EC:3.4.11.3]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    100664517 (LNPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100664517 (LNPEP)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.3  cystinyl aminopeptidase
     100664517 (LNPEP)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100664517 (LNPEP)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N pP_pnuc_1
Other DBs
NCBI-GeneID: 100664517
NCBI-ProteinID: XP_010587897
Position
Unknown
AA seq 1023 aa
MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
HEMDEDEEDYESSAKLLGMSFMNRSSGLRNSAAGYRQSPDGACSVPSARTMVVCAFVIVV
AVSVILVIYLLPKCTFTKEGCHKKNQSMGLIQPLATNGKLFPWAQIRLPTAIKPLRYELN
LHPNLTSMTFRGSVTISVQALQATWNIILHSTGHNISRVTIMSAVSSQEKQVEVLEYPFH
EQIAIVAPEALLEGHNYTLKIEYSANMSSSYYGFYGISYTDESNEKKYFAATQFEPLAAR
SAFPCFDEPTFKATFIIRIIRDEQHTALSNMPKKSSAFMEDGLVQDEFSESVKMSTYLVA
FIVGEMKNLSQDINGTLVSIYAVPEKIDQVHHALETTVKLLEFYQNYFEIQYPLKKLDLV
AIPDSEAGAMENWGLLTFREETLLYDNNTSSASDRKLVTKIIAHELAHQWFGNLVTMQWW
NDLWLNEGFATYMEYFSLEKIFEEFSSYEDFLDARFKTMKKDSLNSSHPISSSSVQSSAQ
IEEMFDFLSYFKGASLLLMLKTYLSEDVFQHAVVLYLHKHSYASIQSDDLWESFNEVTNK
TLDVKKMMKTWTLQKGFPLVTVQRKGKELVVQQERFFLNIKPEIQPSDASYLWHIPLSYI
TDGKNSQSVSLLDKKSGVINLTEEVKWVKVNINMNGYYIVHYADEDWEALIKQLKTNPYV
LSDKDRANLINNIFELAGIGKVPLQRAFDLIDYLGKENHTAPITEALFQTGLICNLLEKR
GHMDLASRLVTRVFKLLQNQIQQQTWTDKGTPSMRELRSVLLDFACTHSLENYSATAVKL
FDDWVASNGTQSLPTDVMTTVFKVGAKSEKGWLFLLSKYITIGSEAEKNKILEALASSED
VRKLYWLMKNSLDGDVIRTQKLSFIIRTVGRRFPGHLLAWDFVKENWNKLVQKFHLGSYT
IQSIVAGSTHLFSTKAHLSEVQAFFENESEATFRLRCVQEALEVIQLNIQWMEKNLKSLT
SWL
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggagccgtttaccaatgatcggcttcagctcccccggaatatgattgaaaacagcatg
tttgaggaagaaccagatgtggtggatttagccaaagagccctgtttacatcctctagag
cctgatgaagtagaatatgagccccggggttcacgtctgctggtgcggggtcttggggag
catgagatggatgaggatgaagaggattatgagtcatctgcaaagctgctgggcatgtcc
tttatgaacagaagctcaggccttcggaacagtgcagccggctacaggcagagccctgat
ggcgcttgttcagtcccctccgcaaggaccatggtggtctgtgcttttgtcattgtggtt
gccgtttctgttatcttggtgatttacctattgcccaaatgtacctttaccaaagaaggc
tgccataaaaaaaaccaatcaatgggactaattcagccacttgcaacaaatgggaaattg
tttccatgggcacaaatcaggcttcccactgccattaagccactacgctatgaacttaac
ctacacccgaacctaacctcgatgacattcaggggttctgtgacaatttcagttcaagct
cttcaggccacgtggaatatcattcttcatagcacaggccataatatttcaagagtgacc
attatgtcagcggtttcaagccaagaaaagcaagttgaggtcctggaatatccatttcat
gaacaaattgccattgttgcccctgaagcgcttctagaagggcacaattataccttgaag
atagagtattcggcaaatatgtctagttcttactatgggttttatggcatctcctacaca
gatgaaagtaatgagaaaaagtactttgcggcaactcagtttgaacccctggcagcaaga
tctgcttttccgtgttttgatgagccaacatttaaagccacatttatcatcaggatcata
agggatgagcaacacactgctttatcaaatatgcctaagaaatcttcggcctttatggaa
gatggactcgttcaggatgagttttctgagagcgtgaagatgagcacttacttggttgcc
ttcatcgtgggggagatgaagaacctgagtcaggacattaacggaaccctggtttctata
tatgctgtaccagaaaagattgatcaagttcaccatgctttggaaacaactgtgaaactt
cttgagttttatcaaaactactttgaaattcaatacccacttaagaaactagatttggtg
gctattcctgactctgaagcaggagcgatggaaaattggggtttgctcacctttcgagaa
gagacacttctgtacgataataatacttcttcagcgtcagatagaaaactggttactaaa
atcattgctcatgagctggcccatcagtggttcggtaatctggtaacaatgcagtggtgg
aatgatctgtggctgaatgaaggttttgccacctacatggagtatttttctttggaaaaa
atatttgaagagttctcaagttatgaagatttcttagatgctcgatttaaaaccatgaag
aaagattctttgaattcatctcatccaatatcatcatcatctgttcagtcttcagcgcag
attgaagaaatgtttgattttctttcctattttaagggagcttccctcttgttgatgctg
aaaacttaccttagtgaagatgtgtttcaacatgctgttgtactttacctgcataagcat
agctatgcgtccattcagagtgacgatctgtgggagagttttaacgaggtcacaaacaaa
acattagatgtgaagaagatgatgaaaacctggaccctgcagaaaggatttcccttagtg
actgttcaaaggaaaggaaaggaacttgttgtacaacaagagagattctttttaaatata
aagcctgaaattcagccttcagatgcaagctacctgtggcatattccactatcctatata
actgatggaaaaaattctcaatcagtatccttactggataagaaatcaggtgtcatcaat
cttacagaagaagtaaagtgggtcaaagtcaatataaacatgaatggctattatattgta
cactatgcagatgaggactgggaagcactgatcaaacagctgaaaacaaatccttatgtt
ctgagtgataaagaccgagccaacctcatcaacaacatctttgaacttgcaggcattggc
aaggtgccccttcaaagggcctttgatttgattgattatcttggaaaggagaaccacact
gcgcccatcactgaagccctgttccagacaggcctcatctgtaacctcctagaaaaacgg
ggacacatggatctggcctcaagactggtgaccagagtatttaaattacttcaaaaccaa
atccaacaacaaacctggactgataagggcaccccatctatgcgagagctccggtcagtc
ttgctagactttgcttgtacccatagcctagagaactacagcgctactgccgtgaagctc
tttgatgattgggtggcatccaatggaactcaaagcctacctactgatgtcatgactact
gtgttcaaagttggagcaaaaagtgagaaaggctggttattccttttaagcaagtacatc
actataggctctgaagcagagaagaataaaatacttgaagctcttgctagctcagaggat
gtacggaaactttactggttaatgaaaaatagcctcgatggagatgtcatccgaacacag
aagctgtccttcatcattagaacagtgggccgacgttttcctggacacttactagcgtgg
gattttgtcaaagagaactggaataagcttgtacagaagtttcatctggggtcctatacc
atacaaagtatagttgctggatcaactcacctgttttccacgaaggcacatttgtctgag
gtccaggcgttctttgaaaatgagtcagaggcaacatttcggctgcgttgtgtccaggag
gctttggaagtcattcagctcaacatccagtggatggagaagaatttaaaatctctgacg
tcgtggctgtag

DBGET integrated database retrieval system