KEGG   Loxodonta africana (African savanna elephant): 100664560
Entry
100664560         CDS       T04351                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lav03021]
    100664560 (AFF3)
Transcription machinery [BR:lav03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100664560 (AFF3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 100664560
NCBI-ProteinID: XP_023408331
Position
Unknown
AA seq 1153 aa
MKDFLTDRSNQSHLVGVPKTGVPQTPVSEMGEHSVADSRAQTQASSVCSSAPSTPAAVPV
QQSKRGTMGWQKAGHPPSDGPQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQDR
PPAMVAKHSSGGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETS
VHCTSYRGVPATKPESARTKAKLSKFSIPKQGEESRAGESNSCVEEIIREMTWLPPLSAI
QPPGKVEPSKFPFLNKDSQLVSSGHNNPKKSDAEPQSPDNGPASTSMLEDDLKLSSDEEE
NEQQAAQRTALRTLSDSTVVQQSNCRASVPSSKGSSSGSSSGSSSSSSDSESSSGSDSET
ESSSSESEGSKPPHYPSPEAEPASSNKWQLDKWLNKVNPHKPAILIQNESQGPEGNQYYT
PVKDDTQECGKLPDLCQTSLRDKEIKSACKEEQRPRTANKAPGSKGVKQKSPPAAVAVAV
TATAPLPAVPSAPAESTPAPARRAAGKKPTRRTERTSAGDSANCHRPEEPPAGDALGASV
VVPPEPTKSRPCGNSRTGHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSD
SDLESEQEEYPLSKPQAGPPSSLSSGGDQRLKEAANSISGGGGPRAPVGSINARTTSDIA
KELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPVVLSTPAAK
DAESAPPTSLLSDTPPEKTLPKSKRKRKCDNEDDYREIKKAQAEKETTSRLTTSTNNIVS
ANHCNTSVSSLAIPINKNEKMLRSPISPLSDASKHKYSNEDLNSSSRPNGNGLFTSASST
KKHKAENQLLSHAGDLAKAAHNNSDNVLLHNKSRLQTEPWSPVSNGHRDCKRQKLVFDDM
PRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYS
ETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDY
FKNSSKAAQAPSPWGASGKSTGTPSPISPNPSPTSSVGSQGSLSTSSALSPSPIVSIPQR
IHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQ
QGLHWLRNSTHLS
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgaaagacttcttaacggataggtccaatcagagtcatcttgtgggcgttcccaaaact
ggggttccgcagactcccgtgagcgagatgggtgagcattccgttgcggattccagagcc
cagacccaggcctcgtccgtctgtagctctgcaccttccacaccagcggctgtcccggtg
cagcagagtaagcggggcaccatgggctggcaaaaggctgggcacccaccatctgatggc
ccacagagggcaacacaacaaggctctctcaggaccttgctcggagatggtgtcggcaga
cagcagccacgggccaaacaagtgtgcaatgtggaggtgggtcttcagacccaggacagg
ccacctgctatggtggccaagcacagcagtggcggacactgtgttcaaaactttcctcca
tccctggcttccaaacccagcctggtccagcagaagccaactgcatacgtgcggccaatg
gacggccaagatcaggctcccgatgagtctcctaagctgaagtcatctacggaaaccagt
gtgcactgcacgtcatacaggggagtcccggccaccaagccagagtcagccagaaccaag
gccaagctttccaagttcagcatccccaaacaaggagaggagagtagagctggagaaagc
aacagctgtgttgaagaaataatccgggagatgacctggcttccaccactttctgccatt
cagccacctgggaaagtggaaccaagcaaatttccatttctaaataaggactctcaactt
gtatcctccggacacaataatccaaagaaaagcgatgctgaaccacagagcccagacaat
ggtccagcaagtacatcaatgctggaagatgacctcaagctaagtagtgacgaggaggag
aatgaacagcaggcagcacagagaactgctctccgcactctatctgacagcaccgtggtc
cagcagagcaactgcagagcctccgtgccgtccagcaagggcagcagcagcggcagcagc
agcggcagcagcagctcctccagcgactccgagagcagctctggctccgactcggagacc
gagagcagttccagcgagagcgagggcagcaagcctccgcactatcccagccccgaggct
gaaccagcatcctctaacaagtggcagctggataaatggctgaacaaggtcaatccccac
aagcctgctattctgatccagaatgagagccaggggccagagggtaatcaatactacact
ccagtgaaagacgacacacaggagtgtggaaaactcccggatctttgccaaaccagcctg
agagacaaggaaatcaagagcgcctgcaaggaggagcagaggccccggacagccaacaag
gccccggggagtaagggagtgaagcagaagtccccacctgcggcagttgctgtggccgtg
accgcaaccgcccctctgcccgcagtgcccagtgcgcctgcagagagcacgcctgcacca
gctcggagggcagcaggcaagaagcccacgcggcgcacagagaggacctcggcgggcgac
agtgccaactgccaccggcccgaggagcccccggccggggatgctctgggagccagcgtg
gtggtccccccagagcccaccaaaagcaggccctgcgggaacagcaggacaggccacagg
aaggagctccgctcctcggtgacctgtgagaagcgacgtacacgggggctgagcaggatc
gtccccaaatccaaggagttcattgagacagagtcttcgtcttcctcatcctcctcagac
tctgacctcgagtccgagcaagaggaataccctctgtccaagcctcaggccgggcccccc
tcatccttgtcctctggcggtgaccagagactgaaggaggctgcaaacagcatcagcggt
gggggcggcccccgggcccccgttggctccatcaacgccaggaccaccagtgacattgcc
aaggagctggaggagcagttctacacgttggttcccttcggccggaacgaacttctttcc
cccctgaaggacagtgatgaggtcaggtctctctgggtcaaaattgacctgacccttctg
tccaggatcccagagcacctgccccaggagccagtggtcctgagcacacctgcagccaag
gacgcagagagcgcacctcccaccagcctcttgtcagacacaccccccgaaaagactctg
ccaaaatccaagaggaaacgcaagtgtgacaacgaagatgactaccgggagatcaagaag
gcccaggcagagaaggagaccacctcccgcctgaccacttccaccaacaatattgtgtct
gcaaatcactgcaacacgagcgtcagcagcttggcaataccaataaataaaaatgaaaaa
atgctccggtcacccatctcacccctctccgatgcctctaaacacaaatactccaacgag
gacttaaactcatccagcaggcctaacggcaatgggctgtttacttctgcctcctccacc
aaaaagcataaggccgagaaccagctgctctctcacgctggagacctcgcgaaagctgca
cacaacaattctgacaacgttctccttcacaacaagtcacggctacaaacggagccatgg
tctcccgtctccaacggacacagggactgcaagaggcagaagctagtcttcgatgatatg
ccacgcagtgcggattattttatgcaagaagctaaacggatgaagcataaagccgatgca
atggtggaaaagtttggaaaagctttgaactacgctgaagcagccttgtcattcattgag
tgtggaaatgcaatggaacaaggtccaatggaatccaagtctccttatactatgtattca
gaaacagtagaactgatcaggtacgccatgagactaaaaacccactcaggccccaatgcc
acaccagaagacaaacaactggctgcattatgttaccgatgcctggctctcttgtactgg
cggatgtttcggctcaaaagggaccacgctgtaaagtattcaaaagcacttatcgactat
ttcaagaactcttccaaagctgcccaggccccatctccgtggggggccagtggaaagagc
actgggaccccatcccccatatctcccaacccctctcccaccagctccgtgggatcccag
gggagcctctccaccagcagcgccctgtccccgtcacccatcgtcagcataccccagcgc
atccatcagatggcagccaatcacgtcagcatcaccaacagcatcctccacagttacgac
tactgggagatggccgacaacctggccaaggagaacagagaattcttcaacgacctggat
ctgctgatggggcctgtcaccctgcacagcagcatggaacacctggtccagtactcccag
cagggcctgcactggctacggaacagcacccacctgtcgtag

DBGET integrated database retrieval system