KEGG   Loxodonta africana (African savanna elephant): 100665758
Entry
100665758         CDS       T04351                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100665758 (RDH5)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100665758 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 100665758
NCBI-ProteinID: XP_003405155
UniProt: G3T764
Position
Unknown
AA seq 318 aa
MWLPLLLGALLWGVLWLLRDRQSLPSSDAFIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPAGAEDLQRVASSRLHTILLDVTDPQSVQWAAKWVKTQVGEAGLFGLVNNAGVAGIIGP
TPWLTWDDFHRVLSVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNLESLEDALQACWVRLPSATQAQYGEA
FLTKYLKVQQCIMNLLCDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDTVLTWVLPKPAQAVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggcttcctctgctgctgggtgccttgctctggggagtattgtggttgctccgagac
cggcagagcctgccctccagcgatgccttcatcttcatcaccggctgtgactcaggcttt
gggcggcttctagcactacgactggaccagcgaggcttccgcgtcctggccagctgcctg
acccccgcaggggctgaggacctacagcgagtggcctcctcccgcctccacaccatcctg
ctggatgtcactgatccccagagtgtccagtgggcagccaaatgggtaaagacacaggtt
ggggaagcaggactttttggtctggtgaacaatgctggtgtggctggtatcatcgggccc
acaccatggctgacatgggatgatttccaccgcgtgctgagtgtgaacaccctgggtccc
atcggggtcacccttgccctgctgcccctgttgcaacaggcccgtggtcgggtagtcaac
atcaccagcgtcctgggtcgcttggcagccaatggcggtggctactgtgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgggatgtggccccttttggtgtaagggtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctggagagtttggaggac
gccctgcaggcctgctgggtgcggctcccttctgccacacaggctcaatatggagaggcc
ttcctcactaagtacctgaaagtacagcaatgtatcatgaacctgctctgtgacccagac
ctgaccaaggtgagcagatgcctggagcatgccctgactgcccgtcacccccgaacccgc
tacagcccaggctgggatgccaagttgctctggctaccggcctcctacctgccagccagc
ctggtggacactgtgctcacctgggtccttcccaaacctgcccaggcagtctactga

DBGET integrated database retrieval system