KEGG   Loxodonta africana (African savanna elephant): 100666753
Entry
100666753         CDS       T04351                                 

Gene name
ANKRD53
Definition
(RefSeq) LOW QUALITY PROTEIN: ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100666753 (ANKRD53)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100666753 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 100666753
NCBI-ProteinID: XP_010592002
Position
Unknown
AA seq 500 aa
MRNYSTSIMMAGLLLRHKGLPSSTLAPLRSPPQPPRGAPRQDAVHARSPFLAQPQSHVHT
SLKEESGQRETGNYELFAAAVGNVEWLRFCLSRNTGEIPADSKAFTAIHFAAQXGKLACL
QVLVEEYKFPVNQPTNNGQTPLHLVVHRDNKTMVLPCIHYLLKKKAAINAQTQSGRTPLH
MAAREGLLGCLKVLVENGANVHAQDAMGCKPIDLCKIRNHRTCARFLKDAMWKRDKKDFA
REMEDLKRLKDRLILLERHYLIEYQKECEALNEADFKKWLHCKLLLARNTKQAPGASPSA
TAPTKTPKCPGSQPSKSYHPFLKARLRHKPQPTLQPMGARISSLYRPSIVTRPKLWSQCS
NPARVPTAKIGYPQGIHLGVQLDPTQEHDLCNFVKVSPDGQGGALLHTVTGRLVAPVPQL
PFEVVVHELYPSQQPYRMKVPQGFYPVSLRDVPRKWRLGDSTFWTDTLAMNLRETFDETF
LTALRAHQGLPILPLPEVSP
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgcgaaactacagcacatccattatgatggctgggctattgttgcgtcacaagggactg
ccctcatccacgctggcgcccctccgcagcccgccccagcctccccgaggggcaccccgc
caggacgccgtccacgcccgcagccctttccttgctcagccccagtcccatgttcacact
agcctcaaggaggagtccggccagagggagactgggaactatgagttattcgcggctgcg
gtgggcaacgtcgaatggctgcggttctgtttgagtcggaacactggggaaatcccagca
gacagcaaggctttcaccgccattcactttgcagcccagncgggcaagcttgcatgcctg
caggtcttggtggaggaatacaagtttcctgtgaaccaacccaccaacaatggccagacc
cccctgcacctagttgtccacagggacaacaagaccatggtcctcccctgcattcactat
ctgctcaagaaaaaggcggccatcaatgctcaaacacaaagtggccgcactcccctgcac
atggcagcccgtgagggcctgttggggtgtttgaaggtcctggtagagaatggtgccaat
gtccatgcccaagatgccatgggctgcaaacccatcgacctatgcaaaatacggaaccac
cgcacctgtgcccggttcttgaaggatgccatgtggaaacgggacaagaaggactttgcc
cgtgagatggaggacctgaagaggctcaaggacaggctgatcctcttggagcggcattac
ctgattgagtatcagaaagagtgtgaagccctgaatgaagctgatttcaagaagtggctc
cactgcaagctgctgctggcccgcaacaccaagcaggcacctggtgcctcaccttcagcc
actgcccccacaaagacccccaagtgccctggatcgcagccttctaagagctatcaccct
ttcctgaaggcacgcctgcgacacaagccacagcccacactgcagcccatgggagcacga
atatcctcgctgtataggccgtccatagtcacacggcctaagctgtggagccaatgcagt
aaccctgccagagtccccaccgccaagatcggctacccgcagggcatccacctgggtgtg
cagctagaccccacccaggagcatgacttatgcaacttcgtgaaggtgagccccgacggg
caaggaggcgcgctgctgcacacagttactggccgcctggtggcacctgtgccccaactg
ccttttgaagtcgtggtccatgagctgtacccctcgcagcagccatacaggatgaaggta
ccccagggtttctaccccgtcagcttgagggacgtaccccggaagtggcgcctgggtgac
agcaccttctggacagacactttggccatgaacctgcgtgagacatttgatgaaacgttc
ctgacagcgctgcgtgctcatcaaggacttcccatcctgcccttgcccgaagtttcccca
taa

DBGET integrated database retrieval system