KEGG   Loxodonta africana (African savanna elephant): 100667057Help
Entry
100667057         CDS       T04351                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100667057 (PLA2G4E)
   00565 Ether lipid metabolism
    100667057 (PLA2G4E)
   00590 Arachidonic acid metabolism
    100667057 (PLA2G4E)
   00591 Linoleic acid metabolism
    100667057 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    100667057 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100667057 (PLA2G4E)
   04010 MAPK signaling pathway
    100667057 (PLA2G4E)
   04370 VEGF signaling pathway
    100667057 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    100667057 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100667057 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100667057 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    100667057 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    100667057 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100667057 (PLA2G4E)
   04913 Ovarian steroidogenesis
    100667057 (PLA2G4E)
   04921 Oxytocin signaling pathway
    100667057 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100667057 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    100667057 (PLA2G4E)
   04726 Serotonergic synapse
    100667057 (PLA2G4E)
   04730 Long-term depression
    100667057 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100667057 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100667057 (PLA2G4E)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100667057 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 100667057
NCBI-ProteinID: XP_023414478
Position
Unknown
AA seq 834 aa AA seqDB search
MLQRKMPAWVSHDLPDPCTAKDSRPSTTCAPEEGLSPCHLLTVRVIRMKNVRQADVLSQT
DCFVTLWLPTASCEKLRTKTISNCSNPEWNETFNFQIQSQVKNILELSVCDEDTVTPDDH
LLTVLYDLTKLCFRKKTHVKFPLNPEGMEELEVEFLLEESPSAPETLITNGVLVSRQISH
LEVHAEARRQRKSRKKEGLLVTVHESFEHTQHLLPCLEPCHPDPACFHYPKYFQPRICVE
VPKSHWSCGLCCCRARKSSPVCQPLDCLPDGHIMTLPVGENCELHMKSTDCPDVLDVRLG
YSLCPAELEFLEKRKVVVARALKQVLQLEEDLQADEVPLIAIMATGGGTRSMTSMYGHLL
GLQKLNILNCAAYIAGLSGATWTMATLYQDPEWSSKNLEPAVFEARRHVVKDKLPALFPD
QLLKYKEELRQRSQEGYRVTFNDFWGLLIEACLGDKRNECKLSEQRAALCRGQNPLPIYL
TINVKDDVSNQDFREWCEFSPYEVGLQKYGAFVPTELFGSEFFMGRLTKRIPESQMCYML
GLWSSIFSLNLLDAWNLSHTSEEFFHRWTRERVHDIEDEPLLPEIPKCDANALETTVVIP
GSWLSNTFRDILTHRSFVSEFHNFLRGLQLHTDYLQNGQFSKWKDTVLDGFPNQLTESVN
HLCLLDTAFFVNSCYPPLLRPERKADLIIHLNYCAGSQTKPMKQTCEYCTVQNIPFPRYE
LQEDDDHLKECYLMENPQDPEAPIVAFFPLINGTFQKYKAPGVERSPEELEHGQVDIYGP
KTPYATKELTYTEAAFDKLVKLSEYNILNNSDKLLQALRLAVEKKKRLKGQCPS
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaggaagatgcccgcctgggtctcccacgacctgccagacccatgcacagca
aaagacagcagaccctcaaccacctgtgccccagaggagggactgtctccatgccacctg
ctgacagtgagggtcatccggatgaaaaatgtccgtcaggctgacgtgttgagccagaca
gactgctttgtgaccctctggctgcccacagcctcttgtgaaaagctgaggactaagacg
atctccaactgctcaaacccagagtggaatgaaaccttcaacttccagatccagagccaa
gtgaagaacattttagagctgagcgtctgtgatgaagacacagtgacgccagacgaccat
ctcttgacagttctctatgacctcaccaagctctgcttccgaaagaaaacccacgtgaaa
ttcccacttaaccctgagggcatggaggagctggaggtagagttcctgctggaggagagt
ccctctgcacctgagaccctcatcaccaacggtgtcctggtgtcccggcaaatctcccat
ttggaggtacacgcagaagccaggcgtcagaggaagagcaggaaaaaggagggcctcttg
gtgacggtgcacgagtcctttgaacacacccagcacctcttgccctgcctggagccctgc
cacccagaccctgcctgcttccactaccccaagtacttccagccccggatatgtgtggag
gtgcccaagagccactggagctgtgggctttgctgctgcagagcccgcaagagcagccct
gtctgccagcccctggactgccttcccgatggccatatcatgaccctgcctgtgggtgag
aactgtgaattacacatgaagtctacagactgccccgacgtgctggacgtgcggctgggc
tacagcctgtgcccggcagagctggagttcctggagaagcggaaggtggtggtagctcgg
gcgctgaagcaggtgctgcagctggaggaggacctgcaggcagatgaggtaccgctgata
gccatcatggccaccgggggagggacaagatccatgacctccatgtacggccacctgctg
gggctgcagaagctgaacatcctgaactgtgccgcctatatcgccggcctgtcaggggcc
acctggaccatggctaccttgtaccaagaccccgaatggtcctccaaaaacctggagcct
gctgtcttcgaggcccggaggcatgtagtcaaggacaagctaccagctctgttcccagac
cagctccttaaatacaaggaggaactccggcagcgtagccaggaaggctacagggtcacc
tttaatgacttctggggcctgctgatcgaggcctgtctgggagacaagagaaacgaatgc
aaactgtcagagcagcgagccgctctgtgccgaggccagaaccccctgcccatctacctc
accatcaatgtcaaggatgatgtaagcaaccaagacttcagagagtggtgtgagttctcc
ccctacgaggtgggcctgcagaagtacggggccttcgtccccaccgagctcttcggctcc
gagttcttcatggggcggctgacgaagaggatccctgagtcgcaaatgtgctacatgcta
ggtttgtggagcagcatcttctccctgaacctgctggatgcctggaacctgtcccatacc
tcggaggagtttttccacaggtggacgagagagagagtgcatgatattgaagacgagccg
ctcctgcctgaaatccccaaatgtgacgccaacgccctggagaccacggtggtgatccca
gggtcatggctgtccaacactttccgcgacatcctcacccatcggtcctttgtgtctgag
ttccacaacttcctgagggggctgcagctgcacaccgactacctccagaacggccagttc
tccaagtggaaagacacagttctcgacggcttcccaaaccagctgacggagtccgtgaac
cacttgtgcctgctggacactgcgttctttgtcaactcctgctacccaccccttctacgg
ccagagaggaaagctgacctcatcatccacctcaattactgtgccgggtcccagaccaag
cccatgaagcaaacctgtgagtactgcaccgtgcagaacatccccttccccagatatgag
ctgcaagaagacgacgaccatctcaaggaatgctacctgatggagaacccccaggacccc
gaagcccccattgtggctttcttcccgctcatcaatggcaccttccaaaagtacaaggcc
ccaggtgtggagcgaagccctgaagagctggagcatggccaggttgacatttatggtccc
aaaactccctacgccaccaaggagctgacatacacagaagccgcctttgacaagctggtg
aagctgtctgagtacaacatcctgaacaacagcgacaagctccttcaggccctgcgactg
gcggtggagaagaagaaacgcctgaagggccagtgtccctcctga

DBGET integrated database retrieval system