KEGG   Loxodonta africana (African savanna elephant): 100667237Help
Entry
100667237         CDS       T04351                                 

Gene name
DLAT
Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00010  Glycolysis / Gluconeogenesis
lav00020  Citrate cycle (TCA cycle)
lav00620  Pyruvate metabolism
lav01100  Metabolic pathways
lav01200  Carbon metabolism
Module
lav_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100667237 (DLAT)
   00020 Citrate cycle (TCA cycle)
    100667237 (DLAT)
   00620 Pyruvate metabolism
    100667237 (DLAT)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100667237 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 100667237
NCBI-ProteinID: XP_003415675
UniProt: G3T459
Position
Unknown
AA seq 647 aa AA seqDB search
MWRVCAQRAQTAAPRAGFGARCATLRERPGPLCAAPLSSPAPALCNGTTTGYGGVRALCS
FSPSSWPTPRNRFLLQLLGSRGRRCYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKIN
EGELIAEVETDKATVGFESLEECYMAKILVAEGTRDVPVGAIICITVEKPEDIEAFKNYT
LDSSAAPTPQAAPAPSPAAAASPPASSAQPPGSSYPTHMQVVLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
AAFADYKPTEVTDLKPQAPPPTVPSVASVPPAPQPVAPTPSAARPATPAGPKGRVFVSPL
AKKLAAEKGIDLTQVKGTGPDGRIIKKDIDSFVPTKAAPAPAAAVSPPGPGVAPVPTGVF
TDVPVSNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLSVRKELNKMLEGSGKISVNDFI
IKASALACLKVPEANSSWLDTVIRQNHVVDISVAVSTPAGLITPIVFNAHTKGLESIASD
VVSLATKAREGKLQPHEFQGGTFTVSNLGMFGIKNFSAIINPPQACILAIGASEDRLVPA
ENEKGFDVARMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtctgtgcccagcgggctcagactgcagccccgagggcgggtttcggggct
cggtgcgcaacgttaagggagagacctggacctctgtgcgcggccccgctttctagcccg
gctccggcgctttgcaacggcacgaccaccggctatggcggggtccgggcactctgcagc
ttcagccccagctcttggcccacaccgcggaaccgctttctgctgcagcttttggggtca
cgcggccgccgttgttatagtctcccccctcatcagaaggttccattgccttccctttcc
cccacaatgcaggcaggcaccatagcccgttgggaaaaaaaggaaggggaaaaaatcaat
gagggtgaactaattgcagaggtcgaaactgacaaagccacggttggttttgagagcctg
gaggagtgttacatggcaaagatacttgttgccgaaggtaccagagatgttccagttgga
gcaatcatctgtattacagttgaaaaacctgaggatattgaggcctttaaaaattatact
ttggattcctcggcagcacctaccccacaagcagccccagcaccaagccctgctgctgct
gcttcaccacctgcatcttctgctcagcctcctggtagctcatatcccactcacatgcag
gtggttcttcctgccctctctcccaccatgaccatgggcacagttcagagatgggaaaaa
aaagtgggtgagaagctaagtgaaggagacttactggcagagatagagactgacaaggcc
actataggttttgaagtacaggaagaaggttacctggcaaaaatcctggttcctgaaggc
acaagagatgtccctctaggaaccccactctgtatcattgtagaaaaagaggcagatata
gcggcatttgctgattacaagccgactgaagtaactgatttaaaaccccaagcaccacca
cctaccgtaccctcggtggccagtgttcctccagctccccaacctgtagcccctactcct
tcagctgcccgcccagctactcctgctggaccaaagggaagggtatttgttagcccactt
gcaaagaaattagcagcagaaaaggggattgacctcacacaagtaaaagggacaggacca
gatggcagaatcatcaagaaagacattgactcttttgtgcctaccaaagctgctcctgcc
ccagcagctgccgtgtctcccccaggtccaggagtggcaccagttcctacaggtgtcttc
acagatgtcccagtcagcaacattcgccgagttattgcacagcggttaatgcaatctaag
caaaccatacctcattattacctttctattgatgtaaatatgggagaagttttgtcggtg
cggaaagaacttaataagatgttagaagggagtggtaaaatatctgtcaatgacttcatc
ataaaagcttcagctttggcatgtttaaaagttcctgaagcaaattcttcttggctggac
acagttataagacaaaatcatgttgttgatatcagcgttgccgtcagtactcctgcggga
ctcatcacacctattgtatttaatgcacatacgaaaggactggaaagcattgctagtgat
gtcgtttctttagcaaccaaagctcgagagggtaaactacagccacacgagttccagggt
ggaacttttacagtctccaatttaggaatgtttggaatcaagaatttctctgctatcatt
aacccacctcaagcatgtattttagcaattggtgcttccgaagatagactggttccagca
gaaaatgagaaaggatttgatgtggctaggatgatgtctgttacactcagctgtgatcac
cgggttgtggatggagcagttggagcccagtggcttgctgagtttagaaagtaccttgaa
aaacctatcaccatgttgttataa

DBGET integrated database retrieval system