KEGG   Loxodonta africana (African savanna elephant): 100667514
Entry
100667514         CDS       T04351                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav00240  Pyrimidine metabolism
lav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100667514 (DCK)
   00240 Pyrimidine metabolism
    100667514 (DCK)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100667514 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 DUF932 AAA_33 CoaE
Other DBs
NCBI-GeneID: 100667514
NCBI-ProteinID: XP_003414209
UniProt: G3THS0
Position
Unknown
AA seq 260 aa
MATPPKRSCPSPATSSEGTHIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQNEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGRLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNHQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHENWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHGSLVEKVKDFVSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggctaccccgcccaagagaagctgtccatcgcctgcaaccagctctgaggggacccac
atcaagaaaatctccatcgaagggaacatcgctgcagggaagtcaacatttgtgaatatc
ctcaaacaagtctgtgaagattgggaagtggttcctgaacctgttgccagatggtgcaat
gttcaaagtacgcaaaatgaatttgaggaactgacaacatctcagaaaagtggtggcaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccagtcatatgcc
tgcctcagtagaatacgagctcaacttgcctctctcaacggcaggctcaaagatgctgag
aaacctgtgttattttttgagcggtctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaactgagtggacaatttatcaagactggcatgac
tggatgaatcaccagttcggccaaagccttgaattggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataagcatgaaaactggctactgcatagaaca
ctgaaaaccaactttgattatttacaggaggtacctatcttaacattggatgtcaatgaa
gactttaaagacaaacatggaagtctggttgaaaaggtcaaagactttgtgagcactttg
tga

DBGET integrated database retrieval system