KEGG   Loxodonta africana (African savanna elephant): 100667919
Entry
100667919         CDS       T04351                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100667919 (ADAMTS13)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100667919 (ADAMTS13)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100667919 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin Reprolysin_3 Reprolysin_4 TSP1_spondin Reprolysin_5 ADAM_spacer1 Peptidase_M10 TSP1_CCN Reprolysin_2 DUF4953
Other DBs
NCBI-GeneID: 100667919
NCBI-ProteinID: XP_023395175
Position
Unknown
AA seq 1455 aa
MRMRNAGAGREVGGRCRSSPPGGRQGAPSGFPEMWGLPCWGRLPPLCKASLGGLLTAAFF
LLGCCGLSNLQQRFLQALEPVEVASYLGPGSAPFDSGPPSPHLQRQTRAVGNVLHLELLV
AVGPDVHQAHQEDTERYVLTNLNIGSELLRDPSLGAQFRVHLVKMIVLTEPEDAPNITAN
ITSSLLSVCDWSRAVNPADDTDPGHADLVLYITRFDLELPNGDRKVRGVTQLGGVCSSSW
SCLITEDTGFDLGVTIAHEIGHSLGLEHDGAPXQRCGSSSHVMAADVAASARRRPAWSAC
SRQQLRHLLSAGRARCLWDPPRPQPEPAGLLLEAQPGLYYSADEQCRVAFGRTAVACTFA
KESLDVCQALSCHTDPLDHSSCSRLLIPLLDGTECGVDKWCSRGHCRSLAELSPLPAVHG
HWSSWGAPSPCSRSCGGGVATRRRQCNNPRPAFGGRACTGADLQAELCNTQACRTSQLEF
MSEQCAQTEGQPLLLPEGGSTFYRWSSAVQYSQGDSLCRYMCWAVGENFIVRRGDSFVDG
TRCVPSGPREDGTFSLCLSGRCRILGCDGRMDSQQVRDVCQVCGGDNSTCSPHNGSFSGG
RAREYVTFLTVTPNLTSVYVVNRRPLFTHLAVRIRGRYVVAGNGSVSPSTTYPSLLEDSR
LEYRVALTEDQLPHREELHIQGPTQEDIEIQVYRRYSEEYGSLAHPDITFSYFQPKQLHV
GMWAAVWGSCSVSCGAGQRWVTYGCLDQAQNKWVEAAQCEGSPKPPERSEPCAPMPCPAR
SCAIRRREAAASSPALQNRTCVPQAEGQEALGDAGPCSTDEEPPALAPCFGMACHQGWDH
ARRGPFPLRPGYVRCCPETSAEAGAGVPAGLCWGGQAALQKGSEEAAAGPGWMGVEGRVL
GDLEVPSLLLPLQLDVTTPGEEAPSPLGSAGPGALAAHAWIPLSGPCSVSCGQGLRELRS
VCVDPIRGTAVPEELCDPATRPRNQREACQVALCPARWETRALGPCPVTCGGGQVPLAMH
CVRPDHGRTIPLPHAKCGRLPQPRPLEDCSPEPCPARWRVLPPGPCSASCGLGTAQRLVT
CVRLDRGLEIELDEVACAGLERPQATIPCLLADCAYRWHVSTWTEVSMAAGPSLPGGLGV
HLPWALSMGEPRALIHGTPEGGESPCPPPQARKVVCPRRHMPGLSDPLACALLHTRSSFA
EVLQPVGIMQPPPQSSANRGPNPSGICGRQFLEPAGTIDLRGPGQAECVVAIGRPLGEVV
TLYVLESSLDCSVGETLLLWSRLTWRKLCGKLAGTIFSSQANTLVVRQRRVRPDGGLVLQ
YRGRPAQHPSHRECDMQLFGPRGEIVGPSLRPDGRSAGGCRVFIDVAPQARMAIHALVTN
VGMQTKGTEASYILIRDIHSLRTSTFRGQQSFYWESAGSQAEVELSEGFLEARASLRGQY
WTLHRAQEKGGPAQP
NT seq 4368 nt   +upstreamnt  +downstreamnt
atgcggatgagaaacgcgggcgccggaagagaagtggggggccgctgtcggagttccccg
cccgggggccggcagggggcgcccagtggctttcctgagatgtgggggctgccgtgctgg
gggaggctcccccctctctgcaaggccagcctggggggccttctcacggctgcattcttt
ctcctgggctgctgtggactctccaatttgcagcagaggtttcttcaggctttggagcca
gtggaggtggcttcgtaccttggcccgggttctgccccctttgacagcggtcctccctcc
cctcatctccagagacagactcgggctgtggggaacgtcctacacctggagctgctcgtg
gccgtgggccctgatgtccaccaggcccaccaggaggacacggaacgctatgtgctcacc
aacctcaacattgggtcagaactgctgagggacccatccctgggggctcagttccgagtg
cacctggtgaagatgattgtcttgacagagcctgaggatgctccaaacatcacagccaat
atcacctcatcgctgctgagcgtctgtgactggagcagggccgtcaaccccgcggacgac
acagaccctgggcacgctgacctcgtcctctacatcaccaggttcgacctggagttgcct
aacggcgaccggaaggttcggggggtcacccagcttgggggggtctgttcctcctcctgg
agctgcctcattaccgaggacactggcttcgacctgggggtcaccatcgcccatgagatt
gggcacagtctcggcctggagcacgacggcgcaccgnnacagcgctgcgggtctagcagc
cacgtgatggcggcggatgttgccgcgtccgcccgccggcgacccgcctggtccgcctgc
agtcgccagcagctgcggcacctgctcagcgcaggacgggcgcgctgcttgtgggacccg
ccccggccgcagccggagccagccgggctcctgctagaagcgcagccaggcctctactac
agcgccgacgaacagtgccgcgtggcctttggccgcaccgccgtcgcctgcaccttcgcc
aaggagagtctggacgtgtgccaggctctctcctgccacacagaccccctggaccacagc
agctgtagccgccttctcatccccctcctggatgggacggaatgcggagtggacaagtgg
tgctccagagggcactgtcgctcgctagcggagctgtcccccctgcctgcggtgcacggg
cactggtccagctggggggcccccagtccttgctcccgctcctgtggaggaggcgtggcc
accaggaggcggcagtgtaacaaccccagacctgcctttggagggcgtgcgtgtacaggc
gctgatctccaggctgagctgtgcaacacccaggcttgcaggaccagccagctggagttc
atgtcagagcagtgcgcccagacggaagggcagcctctgcttcttcccgaaggcggcagc
accttctaccgctggagctcggccgtgcagtacagccaaggggacagtctgtgcaggtac
atgtgctgggccgtgggcgagaactttattgtgaggcgtggggacagcttcgtggatggg
acccgctgtgtgccgagtggcccgagggaggacgggaccttcagcctgtgcctgtcgggc
aggtgcaggatcctgggctgtgacggcaggatggactcccagcaggtacgcgatgtgtgc
caggtgtgcggaggagacaacagcacctgcagcccacacaacggctccttctcgggcgga
agagccagagagtatgtgacattcctcacggtcacccccaacctgaccagtgtctatgtt
gtcaaccgcaggcctctcttcacacacttggctgtgaggatccgagggcggtacgttgta
gctggaaacgggagcgtctcccccagtaccacctacccctcactcctggaggacagccgc
ctggagtacagggtggccctcaccgaggaccagctgccccaccgggaggagcttcacatc
caggggcctacccaggaagacattgagatacaggtttacaggcgctacagtgaggagtat
ggcagcctcgctcacccagacatcaccttcagctatttccagcccaagcagctgcacgtg
gggatgtgggccgccgtgtgggggtcctgttcggtgagctgtggggcagggcagcgctgg
gtgacctacggctgcctggaccaggcccagaacaagtgggtggaggctgcccagtgtgaa
gggagcccaaagccgccagagcgatcagagccctgcgcccccatgccctgccctgcacgg
tcctgtgccatccgcaggagggaggcagcggcctccagcccagccctacagaacaggacg
tgtgtcccgcaggcggaaggccaggaggctctgggggatgctgggccatgctccacagat
gaggagccacctgcgcttgcgccctgctttgggatggcatgccaccagggctgggatcat
gccaggcgcggccccttccccctcaggcctggctatgtgcgctgctgccctgagacgtct
gctgaggccggggcgggcgtgccagcaggcctctgctggggcgggcaggcggctctgcag
aaaggcagtgaggaggcagccgctggaccggggtggatgggggtggagggccgggtcctt
ggggacctggaggtccccagcctgttgctccccctgcagctggatgtgacaactccaggg
gaggaagctccgtccccactgggcagtgccgggccaggagctctcgctgcacatgcgtgg
attcctctgagtgggccctgctccgtctcctgtggccaaggcctgagggagctgcgctct
gtgtgcgtggacccgatccgtggcacagcagtcccagaagagctgtgtgacccggcaacc
aggcccaggaaccagcgggaggcctgtcaggttgccctgtgccccgcacggtgggagact
cgagccttgggaccatgcccggtgacctgtggagggggccaggtgccactggctatgcac
tgtgtgaggcccgaccacggtcgcaccatccccctgccccatgccaagtgtgggcggctg
ccccagccccgcccccttgaagactgcagcccggagccctgccctgccaggtggagagtc
ctgccacccggcccgtgctcagccagctgtggccttggcactgcccagcgcttggtgact
tgtgtgcggctggaccgaggcctcgagatcgagttggacgaggtggcctgtgcgggcttg
gaacggccacaggccaccatcccttgcctgcttgccgactgtgcctaccggtggcatgtc
agcacctggacagaggtgagcatggcagctgggccctcgctccctggggggctgggagtg
catctgccatgggccctctcaatgggggagcctcgggctttgattcatgggacccccgag
ggtggagaaagtccttgccccccacctcaagcacggaaagtagtttgcccaaggcgccac
atgccaggtctgagtgaccccctggcctgtgcactgctgcacacacgatcctcttttgct
gaggtactgcaacctgtgggcatcatgcagccccctccccaaagctctgctaaccgtggc
cctaacccttcaggtatctgtgggcggcagttccttgagccggcaggaaccattgacctt
cgcggcccagggcaggcggaatgcgtggtggccatcgggcggcccctgggggaggtggtc
accctctatgtccttgagagttccctcgactgcagtgttggggagacgctgctactgtgg
agcaggctcacgtggaggaagctgtgcgggaagctggccggcaccatcttcagctcccag
gccaacacgctggtggtgagacagcgccgggtgcggccggacggtggcctggtgctgcag
tacaggggccggcctgcccagcacccgtcccaccgagaatgtgacatgcagctctttgga
ccccggggtgaaatcgtgggcccctcgttgaggccagatgggaggagcgcagggggctgc
cgggtcttcattgacgtggctccacaggcccggatggccatccacgccctggtcaccaac
gtgggcatgcagaccaaggggaccgaggccagctacatcctgatccgggacatccacagc
ctgaggacctcgacgttccgtgggcagcagtcgttctactgggagtcagcgggcagccag
gcggaggtggagttgagtgagggcttcctggaggcgcgggccagcctgcggggccagtac
tggaccctccatagagcgcaggaaaaggggggcccggcccagccctag

DBGET integrated database retrieval system