KEGG   Loxodonta africana (African savanna elephant): 100668100Help
Entry
100668100         CDS       T04351                                 

Gene name
UBE2F
Definition
(RefSeq) NEDD8-conjugating enzyme UBE2F isoform X1
  KO
K10687  ubiquitin-conjugating enzyme E2 F [EC:2.3.2.23]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100668100 (UBE2F)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100668100 (UBE2F)
Ubiquitin system [BR:lav04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100668100 (UBE2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con
Motif
Other DBs
NCBI-GeneID: 100668100
NCBI-ProteinID: XP_003417947
UniProt: G3TCR7
Position
Unknown
AA seq 197 aa AA seqDB search
MLIPVFRVKAAVMLTLASKLKRDDGLRGPRSSATASDSTRRVSVRDKLLVKEVAELEANL
PCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTRIWHPN
ITETGDICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRD
KEDFRNKVEEYIKRYAR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcttattcctgttttcagggtaaaggcagcagtgatgctaactctggcaagcaaattg
aagcgggatgacggtctcagagggccccgctcctcagccacagcttccgactccacccgg
agggtgtctgtgagagacaagctgctcgtcaaagaggtcgcagaacttgaagctaattta
ccttgtacctgtaaagtgcattttcctgatccaaacaagcttcattgcttccagctaact
gtaaccccagatgagggttactaccagggtggaaaatttcagtttgaaactgaagttcct
gatgcctacaacatggtgccccccaaagtgaaatgcttgaccagaatctggcatccaaac
atcacagagacaggggacatctgtctgagtttactgcgagaacattcgattgacggcact
ggctgggctcccacgcggacgctgaaggatgtggtttggggattaaactcattatttact
gatctcttgaattttgatgatccattgaatattgaagccgcagagcaccatctgcgggac
aaggaggacttccggaacaaagtggaagagtacattaagcgttacgcaagatga

DBGET integrated database retrieval system