KEGG   Loxodonta africana (African savanna elephant): 100668116Help
Entry
100668116         CDS       T04351                                 

Gene name
INSR
Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04072  Phospholipase D signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04520  Adherens junction
lav04910  Insulin signaling pathway
lav04913  Ovarian steroidogenesis
lav04923  Regulation of lipolysis in adipocytes
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease (NAFLD)
lav04960  Aldosterone-regulated sodium reabsorption
Module
lav_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100668116 (INSR)
   04015 Rap1 signaling pathway
    100668116 (INSR)
   04010 MAPK signaling pathway
    100668116 (INSR)
   04066 HIF-1 signaling pathway
    100668116 (INSR)
   04068 FoxO signaling pathway
    100668116 (INSR)
   04072 Phospholipase D signaling pathway
    100668116 (INSR)
   04022 cGMP - PKG signaling pathway
    100668116 (INSR)
   04151 PI3K-Akt signaling pathway
    100668116 (INSR)
   04152 AMPK signaling pathway
    100668116 (INSR)
   04150 mTOR signaling pathway
    100668116 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100668116 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100668116 (INSR)
   04923 Regulation of lipolysis in adipocyte
    100668116 (INSR)
   04913 Ovarian Steroidogenesis
    100668116 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100668116 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100668116 (INSR)
   04213 Longevity regulating pathway - multiple species
    100668116 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100668116 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100668116 (INSR)
   04931 Insulin resistance
    100668116 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100668116 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:lav04090]
    100668116 (INSR)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100668116 (INSR)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100668116 (INSR)
CD molecules [BR:lav04090]
 Proteins
  100668116 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 100668116
NCBI-ProteinID: XP_023396235
Position
Unknown
AA seq 1365 aa AA seqDB search
MIYMWRVCLPVLFSLPVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLS
FPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLM
NITRGAVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCP
ATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRN
FYLDGRCVETCPPLYYHFQDWRCVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCIPECPS
GYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVVNGSLIINIRGGNNL
AAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGESLEVGNYSFYALDNQNLRQ
LWDWSKHNLTITRGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIAVKTNGDQASCEN
ELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWT
VVDIDPPQRSNDPKSQPHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQT
DATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELYELDYCLKG
LKLPSRTWSPPFESEESQKHNQSDYEESASDCCACPKTDSQILKELEESSFRKTFEDYLH
NVVFVPRKTSSGPGAEDPRPSRKRRALGDVGNVTVAVPTIPGFPNVSSTRVPTSPAEHRP
FEKVVNKESLVISGLRHFTGYRIEVQACNQDAPEERCSVAAYVSARTMPEAKADDIVGPV
THEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVXRRHFARERGCRLRGLP
PGNYSCACGATSLAGNGSWTEATHFYVTDYLDVPSNIAKIIIGPLIFVFLVSVVIGSIYL
FLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMV
YEGNARDIVKGEAETHVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQ
PTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVH
RDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSS
DMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTSLMQMCWQFNP
KMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENIPLDQSSHSQR
DEARGRDGGSSLSLKRNYDEHIPYTHMNGGKKNGRILPLPRSNPS
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atgatctacatgtggcgtgtttgcttacctgtcctgttttctcttccagtgtgtcctggc
atggatattcggaacaacctcacccggctgcacgagctggagaactgttctgtcattgaa
ggacatttgcagatattgttgatgtttaaaacgaggcccgaagatttccgagacctcagt
ttccccaaactcatcatgatcactgactacttgttgctcttccgggtctatgggctcgag
agcctcaaggacctgttccccaacctcacagtcatccggggctcacgcctcttcttcaac
tatgcgctggtcattttcgagatggtgcacctgaaggagcttggcctctacaacctgatg
aatatcacccggggggctgtccgcatcgagaagaacaatgagctgtgctacctggccacc
attgactggtcacgcatcctggactctgtggaggataattacatcgtgctgaacaaagac
gacaatgaagagtgcggggacatctgtccgggcactgccaagggcaagaccaactgccca
gccactgtcatcaatgggcagtttgttgagcggtgttggacccatagccactgccagaaa
gtttgcccgaccatctgtaagtctcacggctgcaccgctgaaggcctgtgctgccacagt
gagtgtctgggcaactgctccgagcccgacgaccccaccaagtgcgtggcctgccgcaac
ttctacctggacggcaggtgcgtggagacctgcccgcccctctactaccacttccaggac
tggcgctgcgtcaacttcagcttctgccaggacctgcacaacaaatgcaagaactcacgg
aggcagggctgccaccagtacgtcattcacaacaacaagtgcatccccgagtgtccctct
ggatacacgatgaactccagcaacctcatgtgcaccccatgcttgggcccctgccccaag
gtttgccacctcctggagggcgagaagaccatcgactcggtgacgtctgcccaggagctc
cgggggtgcaccgtggtcaacgggagcctgatcatcaacatccgaggaggcaacaacctg
gcagctgagctagaggccaacctaggtctcattgaagagatttcagggtatctcaaaatt
cgccgatcctacgctctcgtgtcactttccttcttccggaagttacgtctgattcgagga
gagagcctagaagtcgggaactactccttctacgccttggacaatcagaacctaaggcag
ctatgggactggagcaaacacaacctcaccatcactcgggggaaactcttcttccactat
aaccccaagctttgcttgtcagaaattcataagatggaggaagtttcgggaaccaagggg
cgccaggaaagaaacgacattgccgtgaagaccaatggggatcaggcatcctgtgaaaat
gaattacttaaattttcttacatccggacatcttttgacaagatcttgctcaggtgggag
ccatattggccccccgacttccgagacctcctggggttcatgcttttctataaagaggcc
ccctatcagaatgtgacagaatttgacgggcaggatgcctgtggttccaacagctggacg
gtggtggacattgacccgccccagaggtccaacgaccccaagtcacagccccaccctggg
tggctgatgcggggcctcaagccctggactcagtacgccatctttgtcaagaccttggtc
accttttctgatgagcgccggacctatggggccaagagtgacatcatctatgtccagaca
gatgctaccaatccttccgtccctctggatccaatctcagtttctaattcctcatcccag
attattttgaagtggaaacccccttcggaccccaacggcaacatcactcactacctggtt
ttctgggagaggcaggcggaagacagtgagctgtatgagttggattattgcctcaaaggg
ttgaagctgccctcccggacctggtctccaccgttcgagtctgaagagtcccagaaacac
aaccagagtgactatgaagagtcagccagcgactgctgtgcctgtcccaagaccgactct
cagatcctcaaggagctggaggagtcctcgttccgcaagacattcgaggattacctgcac
aatgtggttttcgtccccagaaaaacctcttcaggccctggcgccgaggaccctaggcca
tcgcggaaacgcagggcccttggcgatgttgggaacgtgacagtggccgtgcccacgatt
ccaggtttccccaatgtctcctcaaccagagtgcccactagcccggcagagcaccggccc
ttcgagaaagtggtaaacaaggagtcgctggtcatttctggcctgcgtcatttcactggc
tatcgcatcgaagtgcaggcttgcaaccaagatgccccagaggaaaggtgtagcgtggca
gcctacgtcagcgccagaactatgcccgaagccaaggctgacgacatcgttggtccagtg
acccatgaaatcttcgagaacaatgtcgtccacttgatgtggcaggagccaaaggaaccc
aatggtctgattgtgctgtacgaagtgagttatcggcgatatggcgatgaggagctgcac
ctttgcgtcntccgtaggcattttgcccgggagcggggctgccggctgcgagggctgccc
ccaggcaactacagctgcgcgtgcggggccacctccctggcgggcaatggctcctggacc
gaagccacccatttctacgtaacagactacttggacgtcccatcaaatattgcaaaaatc
atcattggcccactcatctttgtctttctcgtcagtgttgtgattgggagtatttatcta
ttcctgagaaagaggcagccggacggtccattgggaccgctgtatgcttcttcaaaccct
gagtacctcagtgccagcgatgtgtttccctgctctgtctacgtgcctgacgagtgggag
gtaccccgcgagaagatcaccctcctgcgtgagctgggccagggctccttcggcatggtg
tacgagggcaatgccagggacattgtcaagggcgaggcggagacccacgtggcagtgaag
acagtcaacgagtcagccagcctgcgagagcggatcgagttcctcaatgaggcctctgtc
atgaagggtttcacctgccaccacgtggtccgcctcctgggggtggtgtccaaaggtcag
ccgacgctggtggtgatggagttgatggctcacggggacctgaagagctacctccgttcg
ctgcggccagaggctgagaacaatcccggccgccctccccccaccctgcaagagatgatt
cagatggcagctgagattgcagatgggatggcatacctgaatgccaagaagtttgtgcac
cgggacctcgcagctcgcaactgcatggtggcccacgatttcaccgtcaaaattggagac
tttggaatgaccagagacatctatgaaacggattactaccggaaaggggggaagggcctg
ctccctgtgcggtggatggccccggaatcgctcaaggatggtgtctttaccacgtcttct
gacatgtggtcctttggtgtggtcctttgggaaatcaccagcttggcggagcagccttac
caaggcctgtctaacgagcaggtgttgaaatttgtcatggatggggggtatctggatcaa
cctgacaactgtccagagagagtcaccagcctgatgcaaatgtgctggcagttcaacccc
aagatgcggccgaccttcctggagattgtcgacctgctcaaggacgaccttcaccctagc
tttccggaagtttccttcttccacagcgaggaaaacaaggctcccgagagtgaggagctg
gagatggagtttgaggacatggagaacatccccctggatcagtcctcgcactctcagagg
gacgaggccaggggccgggacggcgggtcctcgctgagcctaaagcggaactacgacgag
cacatcccctacacccacatgaacgggggcaagaagaacgggcggattctgcctctgccc
aggtcgaatccttcctaa

DBGET integrated database retrieval system