KEGG   Loxodonta africana (African savanna elephant): 100669335Help
Entry
100669335         CDS       T04351                                 

Gene name
HSPA1A
Definition
(RefSeq) heat shock 70 kDa protein 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03040  Spliceosome
lav04010  MAPK signaling pathway
lav04141  Protein processing in endoplasmic reticulum
lav04144  Endocytosis
lav04213  Longevity regulating pathway - multiple species
lav04612  Antigen processing and presentation
lav04915  Estrogen signaling pathway
lav05134  Legionellosis
lav05145  Toxoplasmosis
lav05162  Measles
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100669335 (HSPA1A)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100669335 (HSPA1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100669335 (HSPA1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100669335 (HSPA1A)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100669335 (HSPA1A)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100669335 (HSPA1A)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100669335 (HSPA1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100669335 (HSPA1A)
  09172 Infectious disease: viral
   05162 Measles
    100669335 (HSPA1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100669335 (HSPA1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100669335 (HSPA1A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lav03041]
    100669335 (HSPA1A)
   03009 Ribosome biogenesis [BR:lav03009]
    100669335 (HSPA1A)
   03110 Chaperones and folding catalysts [BR:lav03110]
    100669335 (HSPA1A)
   04131 Membrane trafficking [BR:lav04131]
    100669335 (HSPA1A)
   03051 Proteasome [BR:lav03051]
    100669335 (HSPA1A)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100669335 (HSPA1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100669335 (HSPA1A)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100669335 (HSPA1A)
Spliceosome [BR:lav03041]
 Complex B
  Other components
   Prp19 complex
    100669335 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    100669335 (HSPA1A)
Ribosome biogenesis [BR:lav03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100669335 (HSPA1A)
Chaperones and folding catalysts [BR:lav03110]
 Heat shock proteins
  HSP70 / DNAK
   100669335 (HSPA1A)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100669335 (HSPA1A)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100669335 (HSPA1A)
Proteasome [BR:lav03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100669335 (HSPA1A)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100669335 (HSPA1A)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100669335 (HSPA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 100669335
NCBI-ProteinID: XP_003422314
Position
Unknown
AA seq 641 aa AA seqDB search
MAKSTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVKVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEDIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIITGLYQGAGGPRAGGFGAQAPQGGSASGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaagcacggccatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcaccgacaccgagcggctgatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacacggtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcagacatgaagcactggcccttccaggtgatcaacgacggagacaag
cccaaggtgaaggtgagctacaagggggagaccaaggcgttctaccccgaagagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgaca
aacgcagtgatcaccgtgccggcctacttcaacgactctcagcgccaggccaccaaggat
gcgggggtgattgcggggctgaacgtgctgagaatcatcaacgagcccacagcggccgcc
atcgcctatggcctggaccggacgggcaagggggagcgcaacgtgctcatttttgacctg
ggtggcggtacgtttgacgtgtcgatcctgacgatcgacgatggcatcttcgaggtgaag
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgagccac
ttcgtggaagagttcaagaggaagcacaagaaggacatcagccagaacaagcgagctgtg
aggcggctgcgtaccgcctgtgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagattgactccttgtttgagggcatcgacttctacacgtccatcaccagggcg
cgcttcgaagagctgtgctccgacctgttccgcagcaccctggagcctgtggagaaggct
ctgcgtgacgccaagctggacaaggcgcagatccacgacctggtcctcgtggggggctcc
acacgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctcaac
aagagcatcaaccccgacgaggcggtggcctacggggcggcggtgcaggcagccatcctg
atgggggacaaatctgaaaacgtgcaggacctactgctgctggatgtggctcccctctcc
ctggggttggagactgccgggggcgtgatgactgccctaatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactccgacaaccagcctggagtgctgatc
caggtgtacgagggcgagagggccatgacgcgagacaacaacctgctgggtcgattcgag
ctgagtggcatccctccggccccccggggtgtgccccagatcgaggtgacctttgacatc
gacgccaatggcatcctgaacgtgacggccaccgacaagagcacgggcaaggccaacaag
atcaccatcactaacgacaaaggccgcctgagtaaggaggacattgagcgcatggtgcag
gaggctgagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtctgccaagaat
gccctggagtcctatgccttcaacatgaagagcgcagtggaggatgaggggctcaagggc
aagatcagtgaggctgacaagaagaaggtgctggacaagtgccaggaggtgatctcctgg
ctggatgccaacaccctggcggagaaggatgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcattactggactgtaccagggtgcgggtggccccagggccggt
ggctttggggctcaagctccccaggggggctctgcctctggccccactattgaggaggtg
gattag

DBGET integrated database retrieval system