KEGG   Loxodonta africana (African savanna elephant): 100670199
Entry
100670199         CDS       T04351                                 

Gene name
TRHDE
Definition
(RefSeq) thyrotropin-releasing hormone-degrading ectoenzyme
  KO
K01306  pyroglutamyl-peptidase II [EC:3.4.19.6]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100670199 (TRHDE)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.6  pyroglutamyl-peptidase II
     100670199 (TRHDE)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100670199 (TRHDE)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100670199
NCBI-ProteinID: XP_003405258
Position
Unknown
AA seq 1024 aa
MGEDDTALRAGGRGLSDPWADSVGVRPRTTERHITVHKRLVLAFAVSIVALLAVTMLAVL
LSLRFDECGASVAPGADGGSAGFPARGGNASFPGPARRNHHAGEDSSLPETGADATPGTP
SAQPPSEEEREQWQPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYV
VLHASRVAVEKVQVAEDRASGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKIIYNAL
IENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHPATYLS
LSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYKETTTKSGVVVRLYARPDA
IRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL
LDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPG
WNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQAADIDRVFDWIAYKKGAALIRMLANF
MGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVI
TILGNTTAENKIIITQQRFIYDISTKTKALALRNNSYLWQIPLTIVVGNRSRVSTEAIIW
VSNKSEHHRITSLDKGSWLLGNINQTGYFRVNYDLRNWRLLIEQLIRNHEVLSVSNRAGL
IDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMESYNVFNEY
ILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW
ISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNL
LNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSK
LISGVTEFLNTEGELKELKSFMKSYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGK
ALRH
NT seq 3075 nt   +upstreamnt  +downstreamnt
atgggggaggacgacaccgcactccgggccggcggcagggggctctcggacccgtgggcg
gattccgtgggagtgcgaccccgcaccacggagcgccacatcacggtacacaagcggctc
gtgttggccttcgccgtgtccatcgtggcgctgctcgcagtcaccatgctcgcagtgctg
ctcagcttgcgattcgacgagtgcggggcgagcgtagcgccgggcgccgacggcggatcc
gcgggtttccccgcgcgcggcggcaacgccagcttcccgggacccgcccggcgcaaccac
cacgcgggagaggactcctcgctgcccgaaacgggcgcggacgccaccccaggtaccccg
tctgcccagccgccgtcggaagaggagcgggaacagtggcaaccgtggacgcagctgcgc
ctgtcgggtcacctcaagccgctgcactacaatttgatgctcaccgccttcatggagaac
tttaccttctcaggggaggtcaacgtggagatagcgtgtcggaacgccacccgctacgtg
gtgctgcacgcctcccgggtggcggtcgagaaggtgcaggtggccgaggaccgggcgtcc
ggtgctgtcccggtggccggctttttcctctatccacaaacgcaggtcctggtggtggtg
ctgaatcggaccttggacgcgcagaggaattacaacctgaagatcatttacaacgccctg
attgaaaacgagctcctgggcttcttccgcagctcctacgtcctccacggggagagaaga
ttccttggtgttactcagttttcacctacacatgccagaaaggcatttccctgttttgac
gagccaatctacaaggctactttcaaaatcagcatcaagcacccagcaacctatttatct
ttatccaatatgccagtggaaacttccgtgtttgaggaagatggatgggttacggatcac
ttttcacagacccctctcatgtccacgtattacttagcctgggcaatttgcaacttcaca
tacaaagaaactaccaccaagagtggggttgttgtgcgattatatgcaagacctgatgct
atcagaagaggatccggggactatgctctccatataacaaagagattaatagaattttat
gaagactactttaaagtgccctattccttgccaaaactcgatcttttagctgtgcctaag
catccgtatgctgccatggagaactggggactaagtatttttgtggaacaaagaatacta
ctggatcccagtgtttcatctatttcttatttgctggatgtcaccatggtcattgttcat
gagatatgtcaccagtggtttggtgaccttgtgactcctgtgtggtgggaagatgtgtgg
ttgaaggaaggttttgctcactattttgaatttgttggcacagactacctctaccctggc
tggaacatggagaaacagaggtttctgacggatgttctgcatgaagtgatgctgctcgac
ggcttggccagttcccatccagtatcacaggaagtgctacaggcagcagatattgacagg
gtgtttgactggatcgcgtataaaaagggtgctgctttaattagaatgctggctaatttt
atgggccattcagtatttcagaggggtttgcaagattatttaaccattcataagtatggc
aatgcagccagaaatgatctctggaatacactgtcagaggctttaaaaaggaatggaaaa
tatgtaaatatacaagaagtaatggatcagtggacgctccagatgggctatcctgttatc
acaatcttgggaaatacaacagcagaaaataagataataattacccagcaacgttttatt
tatgatatcagtactaaaaccaaagcacttgcacttcgaaataacagttacctgtggcag
attccattaaccattgtggtaggaaatagaagccgtgtgtctacagaagcaattatttgg
gtgtctaacaaatcagagcaccacagaataacttctttggacaaaggaagctggttgctg
ggaaacatcaatcaaactggctactttagggtcaactatgacctaaggaattggagatta
ttaattgaacaattaataaggaaccacgaggttctctctgtcagtaaccgagcaggtttg
atcgacgacgccttcagcctagccagagctggctatttgcctcagaatattcccctggag
attatcagatacctgtctgaagaaaaggattttcttccttggcatgctgccagccgagct
ctttatcctctagataaattactggaccgcatggagagctacaatgtcttcaatgaatat
attttaaagcaagttgcaacaacatacatcaagcttggatggccaaaaaataattttaat
ggatcccttgttcaagcatcctaccaacatgaagaactacgcagagaagttataatgctg
gcatgcagtttcggcaacaagcactgtcaccagcaggcatcaacacttatatcagattgg
atttccagcaacaggaacagaataccactaaatgttagagacatcgtctactgtacagga
gtttccctactggatgaggatgtctgggaattcatatggatgaaattccactccaccaca
gcagtttctgagaagaaaatattattggaagctttaacttgtagtgatgacaggaattta
ttaaacaggctcctgaatctgtccctgaattctgaggtggtgctggatcaagatgcgatc
gatgtcataatccacgttgctcgaaatccacatggccgagaccttgcctggaaatttttc
agagataaatggaagatattaaataccaggtatggagaagcattatttatgaattccaaa
cttatcagtggagttacagaatttcttaatactgaaggagaactcaaggagctaaagagc
ttcatgaagagctatgatggggtagctgctgcttctttctcacgagctgtggaaaccgtc
gaagccaatgtgcgctggaaaatgctttatcaagacgagcttttccaatggctaggaaaa
gctttgagacactaa

DBGET integrated database retrieval system