KEGG   Loxodonta africana (African savanna elephant): 100670760Help
Entry
100670760         CDS       T04351                                 

Definition
(RefSeq) glutathione S-transferase A1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00480  Glutathione metabolism
lav00980  Metabolism of xenobiotics by cytochrome P450
lav00982  Drug metabolism - cytochrome P450
lav00983  Drug metabolism - other enzymes
lav01100  Metabolic pathways
lav01524  Platinum drug resistance
lav05200  Pathways in cancer
lav05204  Chemical carcinogenesis
lav05225  Hepatocellular carcinoma
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100670760
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100670760
   00982 Drug metabolism - cytochrome P450
    100670760
   00983 Drug metabolism - other enzymes
    100670760
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670760
   05204 Chemical carcinogenesis
    100670760
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100670760
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100670760
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100670760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100670760
Enzymes [BR:lav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100670760
Transporters [BR:lav02000]
 Other transporters
  Pores ion channels [TC:1]
   100670760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_N_3
Motif
Other DBs
NCBI-GeneID: 100670760
NCBI-ProteinID: XP_003404480
Position
Unknown
AA seq 222 aa AA seqDB search
MAGKPMLHYFNGRGRMESTRWLLAAAGVEFEEKLIESPEDLKKLVNEGSLMFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDIKERALIDMYVEGVADLGEMILLLPVAPPGEKDAK
LALIKEKTTNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELIYYVEELDPSLIANFPL
LKALKARVSSLPTVKKFLQPGSQRKPPLDQKTLEQGRKIFKF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaagcccatgcttcattacttcaatggacgaggcagaatggaatctacccgg
tggctcttggctgcagctggagttgagtttgaagagaaacttatagaatctccagaagac
ttgaaaaagttagtaaatgaggggagtttgatgttccagcaagtgccaatggttgaaatt
gatggaatgaagctggtgcagaccagagccattctcaactacattgccaccaaatacaac
ctctacgggaaggacataaaggagagagccctgattgatatgtatgtagaaggtgtggca
gatttgggtgagatgatccttcttttgccagttgcaccacctggggaaaaagatgccaag
cttgcgttgatcaaagagaaaacaacaaaccgttattttcctgcctttgaaaaggtgtta
aagagccacggacaagactatcttgttggcaacaagctgagcagggctgacattcacctg
gttgaacttatctactacgtggaagagctggaccccagccttattgccaacttccctcta
ctgaaggccctgaaggccagagtcagcagcctccccacggtgaagaagttcctgcaacct
ggcagccagaggaagcctcccctagatcagaaaactttagaacaaggaaggaagattttc
aagttttag

DBGET integrated database retrieval system