KEGG   Loxodonta africana (African savanna elephant): 100670993
Entry
100670993         CDS       T04351                                 

Gene name
ENPEP
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    100670993 (ENPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100670993 (ENPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100670993 (ENPEP)
   04090 CD molecules [BR:lav04090]
    100670993 (ENPEP)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     100670993 (ENPEP)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100670993 (ENPEP)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100670993 (ENPEP)
CD molecules [BR:lav04090]
 Proteins
  100670993 (ENPEP)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF5022 Cyclophil_like DUF1570
Other DBs
NCBI-GeneID: 100670993
NCBI-ProteinID: XP_010588809
Position
Unknown
AA seq 956 aa
MNFAEREDSKRYCIKAKHVAIICAVVVAVGLIVGLSVGLTRSGDSSRDNGQGTTPAPSHS
PPSAGPSDLPPQDQGVCPASEDESGQWKDFRLPDFINPVHYDLEIKPVLEEDTYTGSVSI
SINVSAPTSHLWLHLRETRITQLPVLKNPTGEQVQVRRCFEYTKQEYVVVEAEEELPPSS
GDSTYLLTMEFAGWLNGSLVGFXQTTYTENGITKSIAATDHEPTDARKSFPCFDEPNKKA
TYNISIIHPNDYEALSNMPVEKKESVDDKWNRTTFQKSVPMSTYLVCFAVHQFGSITEQS
KSGKPLTIYVQPEQKHTAVYALNITKSVFDYFEEYFAMEYTLPKLDQIAIPDFGTGAMEN
WGLITYRETNLLYDPNESASSNQQRVASVVTHEIVHQWFGNIVTMDWWDDLWLNEGFASF
FEYLGVEHAEKEWQMRDQMLNEDVLPVQEDDSLMSSHPIVVTVTTPAEITSVFDGISYNK
GASILRMLEDWITPEKFQNGCQIYLARFKFKNAKTSDFWEALEEASDLPVKEVMDTWTKQ
MGYPVLNVHNTRNVAQKRFLLDSKANASEPHSDFGYTWNIPIKWTEDNLSDITVYNRSEK
EGIILKSSNPSGNAFLKINPDHIGFYRVNYEGPTWDWIAANLSLDHKGFSSADRASLIDD
AFALARAQLLDYKKALNLTTYLKMEKDFLPWQRVISAITYIISMFEDDTELYPLIESYFQ
DQVKPIADSLGWNDTGDHITKLLRASVLGLACKTGDREALNNASQLFEQWLSGTVSLPVN
LRLLVYRYGMQNSGNETSWYYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDFLKN
STLIKSQDVFTVIRYISYNSYGKTMAWNWIQLNWEYLVNRYTLNDRNLGRIVTIAEPFNT
ELQLWQMESFFAKYPEAGAGETPREQVLETVKNNIEWLKQNRNTIREWFFDLPRNG
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgaactttgcggagagagaagactctaagagatattgcatcaaagccaaacatgtggct
attatctgtgcggtggtggtggctgtaggattaatagtgggactatccgtgggcttgacc
agatccggagactccagccgagacaacgggcagggcacgactccggctccctcccacagt
ccccccagtgctggaccttcagatctgcctccacaggaccaaggggtctgccctgccagt
gaagacgaaagtggacagtggaaagatttcaggttgccggatttcatcaacccagtgcac
tatgatctggagataaagcccgtgctggaggaggacacgtacacgggcagcgtgagcatc
tccatcaacgtgagcgcgcccaccagccacctgtggctgcacctccgggagacgagaatc
acccagctcccagtgttgaagaatcccaccggggagcaggtgcaagtcaggaggtgtttt
gagtacacaaagcaggaatatgtggtggtggaggccgaagaagagcttccacccagcagt
ggcgatagtacctacctcctgaccatggagttcgccggctggctgaacggctccctcgtg
ggttttnnacagacaacgtacacggagaatggaataaccaagagcatagcagccactgat
catgaaccaacagatgccaggaaatccttcccttgttttgatgagcccaacaaaaaggcg
acttacaatatatctatcattcaccccaatgactatgaagcactttcaaatatgccagtg
gagaaaaaagagtcggtagatgataaatggaatcgaacaactttccagaagtctgtcccc
atgagcacttacctagtgtgttttgctgtacatcaatttgggtccataacggaacaatca
aagagcggaaaacctctcactatttatgtccagccagagcaaaagcacacagctgtatat
gctttaaacataactaaaagtgtgtttgattattttgaagaatactttgctatggagtat
actcttcctaaattagatcaaattgctattccagattttggcaccggtgctatggagaac
tggggcctcatcacttacagagaaactaacctgctttacgaccctaatgaatcagcctct
tctaaccaacagagggtggccagtgtggttacccatgaaattgtgcatcagtggtttgga
aatattgtgaccatggactggtgggatgacttgtggctaaatgaaggatttgcttccttc
ttcgagtacctgggagtagaacatgcagaaaaagagtggcaaatgcgtgaccagatgttg
aatgaagatgtattacctgtacaagaggatgactctttgatgtcttcacacccaattgtt
gtcactgtgacaacccctgccgaaataacatctgtatttgatggaatatcctataacaag
ggagcttccattctccgaatgcttgaagactggataacaccagagaaatttcaaaacgga
tgtcagatatatttggcaagatttaaattcaagaatgcaaagacatcagatttttgggaa
gcactggaagaggcaagtgatctaccagtgaaggaagtaatggacacctggactaaacag
atgggttatcctgtgcttaatgtgcacaatacgaggaacgtcgcacagaagcgttttctg
ttggactcaaaagctaatgcttccgaaccacattcagattttggttacacatggaatatt
ccaattaagtggactgaagataatctatcagatattacggtctacaacaggtcagaaaaa
gaaggaatcattttgaagtcttctaatcctagtggaaatgcttttctcaaaataaaccca
gatcatattgggttttatcgtgtaaattatgaaggaccaacttgggactggatagctgca
aatctctccttggaccacaaggggttttcttctgctgatcgtgccagtcttattgatgat
gcttttgccttggcaagagctcaacttcttgattataagaaggctctgaacttgaccaca
tatctcaaaatggaaaaggattttttaccgtggcagagagtcatttcagctataacctat
attattagcatgttcgaagatgatacagagctataccctctgattgagagttacttccaa
gatcaagtgaagcccattgcagattctctgggttggaatgacactggagaccacataaca
aagttactccgggcctctgtgttagggcttgcatgcaagacgggagatagagaagctttg
aacaatgcttcccagttgtttgagcagtggctaagcggaactgtaagtcttcctgtaaat
cttaggcttctggtatatcggtatgggatgcagaactctggcaatgagacttcatggtac
tacactcttgagcaataccagaaaacatcattagctcaagaaaaagaaaaactgctctat
ggattagcatcagtgaagaacgttactcttttgtcaaggtatttggattttctcaagaac
tcaacccttattaaaagtcaggatgtgtttacagtcatccgatacatatcatataacagc
tatgggaagactatggcctggaattggatacaactcaactgggaatatctagtcaacaga
tacacactcaatgacagaaacctcggccgaattgtcacaatagcagagcctttcaacact
gaactacagctctggcagatggagagcttttttgccaaatatccagaagctggagcggga
gaaacacctagggagcaagtgctggaaacagtgaaaaacaatattgagtggctaaaacaa
aatagaaacaccattagagaatggttttttgatttacctaggaatggctga

DBGET integrated database retrieval system