KEGG   Loxodonta africana (African savanna elephant): 100671084Help
Entry
100671084         CDS       T04351                                 

Gene name
EIF4EBP2
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 2
  KO
K18644  eukaryotic translation initiation factor 4E binding protein 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03013  RNA transport
lav04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100671084 (EIF4EBP2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100671084 (EIF4EBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100671084 (EIF4EBP2)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100671084 (EIF4EBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF_4EBP
Motif
Other DBs
NCBI-GeneID: 100671084
NCBI-ProteinID: XP_023402801
Position
Unknown
AA seq 100 aa AA seqDB search
MGFKLNSWLLLYVDSTLICFKLFETCFPGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPG
VTSPSTLIEDSKVEVNNLNNLNNHDRKHTVGDDAQFEMDI
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggggtttaaactaaattcctggttattattatatgttgatagcaccttaatttgtttc
aaactgtttgaaacctgttttccaggaacacgaatcatttatgatcgaaagtttctgttg
gatcgtcgcaattctcccatggctcagaccccgccctgccatctgcccaatattcctgga
gtcactagccctagcaccttaatcgaagactccaaagtagaagtaaacaatttgaataac
ttgaacaatcatgacaggaagcacacagttggggacgacgctcagtttgagatggacatc
tga

DBGET integrated database retrieval system