KEGG   Loxodonta africana (African savanna elephant): 100671569Help
Entry
100671569         CDS       T04351                                 

Gene name
NDUFS3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial isoform X1
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00190  Oxidative phosphorylation
lav01100  Metabolic pathways
lav04714  Thermogenesis
lav04723  Retrograde endocannabinoid signaling
lav04932  Non-alcoholic fatty liver disease (NAFLD)
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05016  Huntington disease
Module
lav_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100671569 (NDUFS3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100671569 (NDUFS3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100671569 (NDUFS3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100671569 (NDUFS3)
   05012 Parkinson disease
    100671569 (NDUFS3)
   05016 Huntington disease
    100671569 (NDUFS3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100671569 (NDUFS3)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     100671569 (NDUFS3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     100671569 (NDUFS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 100671569
NCBI-ProteinID: XP_003412286
Position
Unknown
AA seq 261 aa AA seqDB search
MAAARGWWRLLVGTAAIARGAGRPSALLLPVRRESAAADTRPTVRPRNDVAHKQLSAFGE
YVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHTNAQFRSLADLTAVDIPTRQ
NRFEIVYNLLSLHFNSRIRVKTYTDELTPIESTVSVYKAANWYEREVWDMFGVFFANHPD
LRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFP
AYREPPESLKLEAGDKKPEAK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgaggggctggtggcggttgcttgtggggaccgcggcaatagcccgggga
gccgggcgaccctcggcgttattgctgcccgtgagaagggagagcgccgcggccgacacg
cgccccactgtcagaccacggaatgatgtggcccacaagcagctctcagcttttggagag
tatgtagctgaaatcctgcccaagtatgtccaacaagttcaggtgtcctgcttcaatgaa
ttagagatctgtatccatcctgatggagtcatcccagtgctgactttcctcagggatcac
accaacgcacaattcagatccttggctgacttaacggcagtggatatcccaacccggcaa
aaccgttttgagattgtctacaacttgctgtccctgcacttcaactcacgaatccgtgtg
aagacctatacagatgagctgacacccatagagtccactgtctctgtgtataaggcagcc
aactggtatgagagggaggtctgggacatgtttggagtcttctttgctaaccaccctgac
ctaagaaggatcctgacagactatggctttgagggacatcctttccggaaggatttcccc
ctgtctggctatgttgagctacgctatgacgatgaggtgaagcgggtggtggccgagcct
gtggagttggcgcaagagttccgcaagttcgacctgaacagcccctgggaggcattccct
gcctaccgcgagccccctgagagtctcaagcttgaggctggagacaaaaaacctgaagca
aagtag

DBGET integrated database retrieval system