KEGG   Loxodonta africana (African savanna elephant): 100671842Help
Entry
100671842         CDS       T04351                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00561  Glycerolipid metabolism
lav01100  Metabolic pathways
lav04714  Thermogenesis
lav04723  Retrograde endocannabinoid signaling
lav04923  Regulation of lipolysis in adipocytes
Module
lav_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100671842 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100671842 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100671842 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    100671842 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lav01002]
    100671842 (MGLL)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100671842 (MGLL)
Peptidases [BR:lav01002]
 Serine Peptidases
  Family S33
   100671842 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Abhydrolase_3 Thioesterase DLH PGAP1 Abhydrolase_5 Abhydrolase_2 LIDHydrolase DUF1057
Motif
Other DBs
NCBI-GeneID: 100671842
NCBI-ProteinID: XP_010588219
Position
Unknown
AA seq 319 aa AA seqDB search
MQTQDTMETGLANPFRMPEESSPRGTPQSAPYQDLPHLINADGQRLFCKYWKPTGEPKAL
VFVSHGAGEHCGRYEELAQMLTGLGLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHV
DVMQRDYPRLPVFLLGHSMGGAISILTAAERPGHFSGMVLISPLVLANPESATTFKVLVA
KVLNFVLPNMSLGPIDSSVLSRNKTEVDLYNADPLICRAGLKVSFGIQLLNAVSRVERAL
PKLTLPFLLLQGSADRLCDSRGAYLLMEQAKSQDKTLKIYEGAYHVLHKELPEVTNSVFQ
EINVWVSQRTAAVGAGSPP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacccaggacacgatggaaacaggacttgcaaatcctttcagaatgccggaggaa
agttctcccagggggaccccacagagtgctccataccaggacctccctcacctgattaac
gctgacgggcagcgccttttctgcaagtactggaaacccacaggcgagcccaaggcactg
gtgtttgtttcccatggagccggggagcactgcggccgctatgaggaactggctcagatg
ctgacgggactgggcctgctggtgttcgcccacgaccatgttggccacggacagagtgaa
ggggagaggatggtggtgtctgacttccacgttttcgtcagggatgtgttacagcacgtg
gatgtcatgcagagagactaccccaggcttcctgtcttccttctgggtcactccatggga
ggtgccatctccatcctcactgccgcagaaaggccaggccacttctccggcatggttctc
atctcacccttggttctcgccaatccggagtcggccacaactttcaaggtccttgttgcg
aaagtgctcaactttgtcctgcccaacatgtccctggggcccatcgattccagcgtgctc
tctcggaataagacagaggtggacctgtacaatgcagacccgctgatctgccgggcaggg
ctgaaggtgtcctttggcatccagctgctcaacgccgtctcccgggtggagcgtgccctc
cccaagctgaccctgcccttcctgctgctccagggctctgcggaccgcctgtgtgatagc
aggggagcctacctgctcatggagcaagccaagagccaggataagacgctcaagatctat
gaaggtgcctaccatgttctccacaaagagcttcctgaagtaaccaactccgtcttccag
gaaataaacgtgtgggtctctcaaaggacagctgcagtaggagccgggtccccaccctga

DBGET integrated database retrieval system