KEGG   Loxodonta africana (African savanna elephant): 100672277Help
Entry
100672277         CDS       T04351                                 

Gene name
THNSL2
Definition
(RefSeq) LOW QUALITY PROTEIN: threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100672277 (THNSL2)
Enzymes [BR:lav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     100672277 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP DUF4715
Motif
Other DBs
NCBI-GeneID: 100672277
NCBI-ProteinID: XP_023395140
Position
Unknown
AA seq 548 aa AA seqDB search
MSETCKVRAKCVLGIIAFRTLLPRFPQPLCAAPDHSSASLLTPRFQDDDNRFQPEARAQP
APDVGWSAEVQSLAAPPPQPLPGLVPAAARVPDPVSRIMWYVSTRGMAPRVDFEGALLSG
YAPDGGLYMPEELPLLGRETLHKWSTLSYPGLVKELCALFIGPELIARDDLHDLIDRAFS
RFRHQEVVHLSRLRNGLNVLELWHGATYAFKDLSLCCTAQFLQYFLEKRERHVTVVVGGN
FWDTGSAAIESXQGAKNVDIIVLLPKGHCSKIQVLQMTTVLKENVHVFGVEGNSDELDEP
IKAVFADVDFVKEHCLMSLXSINWSRVLVYTGCIAQKMGLPIRLVATVNHNDIIHRTVQQ
GDFSLSQAVKPTLASAMDIQVPYNMERIFWLLSSSDSQVTRALMEQFERTQTLRLPRELH
GKLSGAMMSESVSDEAITQAMARCWEENQYLLCPHSAVAVSYHYQQMDRQQSSNTPRCCL
APASAAKFPEAVLAARLTPEAPAEILALEYKETRCAPMQRGDDWTLMLRGTIEDLSRQWR
GRARNASE
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacatgcaaagtgagggctaaatgtgttctgggtataattgcctttcgcact
ctcctcccgcgcttcccacaacccctgtgtgccgcccccgaccactcctcggcgtccctg
ctcactccgcgctttcaggatgatgacaaccggttccaaccggaagcccgagcccagccg
gctcccgacgtggggtggagcgctgaagtccagagcctggcagccccgccgccccaacca
cttcctgggctggttccagcagccgcccgcgtcccggacccggtctccaggatcatgtgg
tacgtcagcacccggggaatggcccctcgggtggactttgagggggccctcttgtctggt
tacgcacccgatgggggcctctacatgcctgaggagctcccactgctgggcagagagact
ctgcataagtggagcacgctgtcctacccaggcctggtgaaggaactgtgcgccctcttc
attggccctgagctcattgcaagagatgacctacatgatctgattgaccgagccttcagc
agattccgccaccaagaagtggtccatctttccaggctgaggaacgggctgaacgtgttg
gagctgtggcatggggccacgtatgcgtttaaagacctgtccctgtgctgtacagcacag
ttcctgcagtacttcctggagaagagggagaggcacgtcaccgtggttgtaggtgggaac
ttctgggatacagggagtgctgccattgagagtngtcaaggggcaaagaatgtggacatt
atcgttttgctgcctaagggtcactgctcgaagatccaggtgcttcagatgacaacagtg
ctgaaggagaatgtccacgtgtttggagtggagggaaacagcgatgagcttgatgagccc
atcaaggccgtgtttgccgacgtggattttgtcaaggagcactgtctgatgagtcttnac
tcaatcaactggtcccgcgtcctggtatacactgggtgcattgctcagaagatgggcttg
cccatccgcctggtggccacagtgaaccacaatgacatcatccacaggactgtccagcag
ggggacttctctctgtcccaggccgtcaaaccaaccttggcatctgcaatggacatccag
gtgccctacaacatggagaggatcttctggctgctctccagctctgacagccaggtgaca
agagccctcatggagcagtttgaaagaacccaaactctgcgtctgcccagggaactgcac
ggcaagctttcaggggccatgatgtctgagtccgtgtcggatgaggccatcacccaggcc
atggcccgctgctgggaagagaaccagtacttgctgtgccctcactcggccgtggctgtg
agctaccattaccagcagatggacaggcagcagtccagcaatactcccaggtgttgcctg
gcccctgcctctgcagccaaattcccggaagctgtcctggcagccaggctgaccccggag
gctcctgcagagatcctagccctagagtacaaggagacccgctgcgccccaatgcagaga
ggtgatgactggacgctgatgcttcggggcaccattgaggacctgagccggcagtggagg
ggccgtgcccggaacgcctcagaatag

DBGET integrated database retrieval system