KEGG   Loxodonta africana (African savanna elephant): 100673588Help
Entry
100673588         CDS       T04351                                 

Gene name
MRPL53
Definition
(RefSeq) 39S ribosomal protein L53, mitochondrial
  KO
K17434  large subunit ribosomal protein L53
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lav03011]
    100673588 (MRPL53)
Ribosome [BR:lav03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    100673588 (MRPL53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 100673588
NCBI-ProteinID: XP_003413628
Position
Unknown
AA seq 104 aa AA seqDB search
MAAALARLGLRVVKEVRVQFCPFEKNVESTRTFLQAVSSEKVRATNLNCVVTVDVRHDGS
EPCVDVLFEDGRRLIMRGFHLTAQEMLTAFIAHIHAKGAGTGRN
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccttggctaggctcgggctccgggtggttaaggaggttcgtgttcagttc
tgtcccttcgagaagaacgtggaatctacaaggaccttcctccaggcggtgagcagcgag
aaggtccgcgccaccaacctcaactgcgtggtgactgtggacgtgaggcacgacggctcc
gaaccctgcgtggacgtgctgttcgaagacggacgccgcctgattatgcgcggcttccac
ctcaccgcccaggaaatgcttactgccttcatcgctcacatccacgcgaagggcgccggt
accgggcggaactga

DBGET integrated database retrieval system