KEGG   Loxodonta africana (African savanna elephant): 100673954
Entry
100673954         CDS       T04351                                 

Gene name
RNPEP
Definition
(RefSeq) aminopeptidase B isoform X1
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100673954 (RNPEP)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     100673954 (RNPEP)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100673954 (RNPEP)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Other DBs
NCBI-GeneID: 100673954
NCBI-ProteinID: XP_023404024
Position
Unknown
AA seq 675 aa
MASGGPSTGGGMARRPLHSAQAVDVASASSYRAFEMLHLHLDLRVQFGPPGPGPGSRELS
GSATLELRCLVPDGASELLLDSHPCLEVTAAVLRREGPGSEGPGSEGPGSEGPGSEGPGS
EGPGSEGPFEEPLAFRTRPFSHYGQVLCVAFPQPCRAGERFQVLLTYRVGEGPGVCWLTP
EQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSANTWEKRGP
NKFFFQMCQPIPSYLIALAIGDLVSAEVGPRSHVWAEPCLIEAAKEEYNGVIEEFLATGE
KLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNL
VTNANWGEFWLNEGFTMYAQRRISTTLFGAAYTCLEAATGRALLQQHIDITGEDHPLNKL
RVKIEPGVDPDDTYNEIPYEKGFCFVSYLAHLVGDQDQFDNFLKAYVDEFKFQSILADDF
LEFYLDYFPELKEKKVDSIPGFEFDRWLNTPGWPPYLPDLSPGDALMKPAEELAQLWVTE
ELDMKAIDAVAISSWKTYQLVYFLDKILQKSPLPPGNLKKLGETYPNVSNARNAELRLRW
GQIVLKNDHQEDFWKVKEFLWSQGKQKYTLPLYHAMVSGSEVAQALAKETFASTASQLHS
NVVNYVQQILEPKGN
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggcgagcggcggaccctcgaccggcggtggcatggcccggcggccgttgcactcggca
caagccgtcgacgtggcctcggcctccagttaccgggccttcgagatgctccacttgcat
ttggacctgcgggtgcagttcgggccgccggggccgggcccaggcagccgggagcttagc
ggctcggcgaccctggagctgcgctgcctggtgcccgatggcgccagcgagctgctgctc
gactcgcacccgtgcctcgaggtgacggcggcggtgctgcggcgggaggggcccggctcc
gaggggcccggctccgaggggcccggctccgaggggcccggctccgaggggcccggctcc
gaggggcccggctccgaggggcccttcgaggagcccctggccttccgcacgcggcccttc
tcgcactacggccaggtcctgtgcgtggccttcccgcagccctgccgcgctggcgagcgc
ttccaggtgctgctcacctaccgcgtcggggagggacctggggtttgctggctgactcct
gagcagacagcaggaaagaagaagccctttgtctatactcaaggccaagccgtgctaaac
cgagccttcttcccttgcttcgacactcctgcagtgaaatacaaatattcagcccttatt
gaggtcccagatggcttcacagctgtgatgagtgccaacacctgggagaagagaggtcca
aataagttcttcttccagatgtgtcagcccatcccctcctatctgatagctttggccatc
ggagatctggtttcggccgaagttggacccaggagccatgtgtgggccgagccctgcctg
attgaggctgccaaggaggagtacaatggggtgatagaagaatttttggcaaccggagag
aaacttttcggaccctacgtctggggaaggtatgacgtactctttatgccgccatccttt
ccatttggaggaatggagaacccttgtctgacctttgtcaccccgtgcctgctagcagga
gaccgctccttggccgatgtcatcatccatgagatctcccacagttggtttgggaatctg
gtcaccaatgccaactggggtgaattctggctgaacgaaggcttcaccatgtatgcccag
aggaggatctccacgaccctctttggggccgcttacacctgcttggaggctgccacgggc
cgggctctgctccagcagcacatagacatcaccggcgaggatcacccgctgaacaagctc
cgagtgaagatcgagccaggtgttgacccagacgacacctacaacgaaatcccctacgag
aaaggcttctgctttgtctcctacctggcccacttggtgggtgatcaggatcagtttgac
aattttctcaaggcctatgtcgatgaatttaaattccaaagtatcttagccgacgacttt
ctggaattctacctggactatttccctgaactaaaggaaaagaaggtggattccattcca
ggttttgagtttgatcgatggctgaatactcctggctggcccccctacctccctgacctc
tcccctggggatgcactcatgaagcctgctgaagagctggctcagctctgggtaactgag
gaactggacatgaaggccattgacgctgtggccatctcttcctggaagacctaccagctg
gtctacttcctagataagatcctccagaagtcgcctctccctcctgggaacttgaaaaaa
cttggagagacatacccaaatgtctcaaacgcccggaacgcagagctaaggctacgatgg
ggccagattgtccttaagaatgaccaccaggaggatttctggaaagtgaaggagttcctg
tggagccaggggaaacagaagtacacccttccgttgtaccacgcgatggtgagtggcagc
gaggtggcccaggccctcgccaaggagacctttgcttccactgcctcccagctccacagc
aacgtggtcaactacgtccagcaaatcctggagcccaagggcaattag

DBGET integrated database retrieval system