KEGG   Loxodonta africana (African savanna elephant): 100674296
Entry
100674296         CDS       T04351                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100674296 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100674296 (ASIC1)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100674296 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 100674296
NCBI-ProteinID: XP_023395100
Position
Unknown
AA seq 486 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETGMSF
SSGATWSWAPSLAAPRPSLSEGTPGLHCRIDCETRYLVENCNCRMVHMPGDAPYCTPEQY
KECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIG
ENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIK
HKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGT
FEDFTC
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggaactgaaggccgaggaggaagaggtgggtggcgtccagccggtgagcatccaggcc
tttgccagtagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtcg
ctgaagcgggcgttgtgggccctgtgcttcctgggctcactggctgtgctgctatgcgtg
tgcaccgagcgtgtgcagtactacttccactaccaccacgtcaccaagctcgacgaggtg
gcagcctcccagctcaccttccctgccgtcacgctgtgcaacctcaatgagttccgtttt
agccaagtctccaagaatgacctgtaccatgccggagaactgctggccctgctcaacaac
aggtatgagataccagacacacagatggcagatgaaaagcagctggagatattgcaggac
aaggccaacttccgcagcttcaagcccaagcccttcaatatgcgcgagttctatgaccgt
gcggggcacgacattcgcgacatgctgctctcctgccatttccggggcgaggtttgtagc
gctgaagacttcaaagtggtcttcacgcggtatgggaagtgctacacgttcaactccggc
cgagatgggcggccacggctgaagaccatgaagggtggaacaggcaatgggctggaaatc
atgctggacatccagcaggacgagtacctgcctgtgtggggggagactggtatgtcattc
tcctcaggggccacctggtcctgggctccatctctcgcggctcccagacccagcctcagc
gagggcactcctgggctccattgccgcattgactgtgagacgcgctacctggtggagaat
tgcaactgccgtatggtacacatgccaggggatgccccatactgcactccagagcagtat
aaggagtgtgcagatcctgctctggatttcctggtggaaaaggaccaggagtactgcgtg
tgcgaaatgccctgcaacctgacccgctacggcaaggagctgtccatggtcaagatcccc
agcaaagcttcagccaagtacctggccaaaaaattcaacaagtctgagcagtacataggg
gagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccattgagcag
aagaaggcctatgagattgcagggctcctgggtgacattgggggccagatggggctgttc
atcggcgccagcatcctcacggtgctggagctctttgactacgcctatgaggtcattaag
cacaagctgtgccgacgagggaagtgtcagaaggaagccaaaaggagtagtgccgataag
ggcgtggccctcagcctggatgacgtcaagagacacaacccgtgcgagagcctccgtggc
catcctgctggaatgacttacgctgccaacatcctacctcaccatccggcccgaggcacg
tttgaagactttacctgctga

DBGET integrated database retrieval system