KEGG   Loxodonta africana (African savanna elephant): 100677289Help
Entry
100677289         CDS       T04351                                 

Gene name
SLC4A1
Definition
(RefSeq) LOW QUALITY PROTEIN: band 3 anion transport protein
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    100677289 (SLC4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100677289 (SLC4A1)
   04147 Exosome [BR:lav04147]
    100677289 (SLC4A1)
   04090 CD molecules [BR:lav04090]
    100677289 (SLC4A1)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   100677289 (SLC4A1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100677289 (SLC4A1)
CD molecules [BR:lav04090]
 Proteins
  100677289 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Motif
Other DBs
NCBI-GeneID: 100677289
NCBI-ProteinID: XP_010592814
Position
Unknown
AA seq 908 aa AA seqDB search
MGDSQDDYEDEMEEILEQEENGELEDTLEDTLDYGGPGVLVSSVGEPAAPLTEPTDTDYH
TTSHPGTHEVYVELRQLVMDEKNKELQWIEAAHWVQLEENLGEDGAWGQPHLSYLTFWSL
LELQSAFTKGTILLDLPETSLVGVANQLLDVFIYEEQIRPRDRDELLRTLLLKHSHAKDL
EDLGSVKPVVLTRSGDPLEPLLPQYPSLETQLFCVKGDRGTEEQLSSGILEKITPGSEAT
LVLVGCTSFLERPVLGFVRLQEASELEALKLPVPVRFLFVLLGPKNPHTDYIQLGRATAT
LMSERVFRTDAYLAQNREELVRSLEGFLDCSLVLPPTDAPSEQALLGLVPVQKELLRRRY
LPHSARPEPDFYKDLGTCPSPAQGFLSPYRFSDTPHSPVNSCLPXTAPLAVKYSSLSPAI
TFGRLLREKTGNQMGVSELLISTAVQGVLFSLLGAQPLLVVGFSGPLLVFEEAFFSFCVD
NGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLI
KIFQDHPLQKHYNVTVDPQLKVPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRR
VIGDFGVPISILIMVMVDFFIKDTYTQKLKVPKGLTVSDPTTRGWVIHPLGLNSPFPIWM
MFASAVPALLVFILIFLESQITTLIISKPERKMVKGSGFHLDLLLVMGMGGAAALFGMPW
LSATTVRSVTHANALTVMSKAKTPGAAAQIQGVKEQRISGLLVAMLVGLSILMEPILSLI
PLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGTQIIC
LVVLWVVKSTPASLALPFVLILTVPLRRFLLPLIFRKLELQCLDADDAKVISDEKEGQDE
YDEVPMPV
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgggagattcgcaggatgattacgaggatgagatggaggagatcctggagcaggaggaa
aatggggagctggaggacactctggaggacactctggattatggaggcccaggtgttctc
gtgtcctcggtgggggaaccagcagctcccctcacagagccaacagacacagactaccac
accacatcgcacccaggcacccacgaggtctacgtggagctgcgccaactggtgatggac
gagaagaacaaggagctgcaatggatagaggcagcacactgggtgcaactggaggagaac
ctgggggaggacggagcctggggccaaccacacctgtcttatctcaccttctggagcctc
ctggagctgcagagcgccttcaccaaggggaccatccttctggatctgccagagacctct
ctggtcggggtggccaaccagctgctggatgtgtttatctatgaggagcagatccggcct
cgggaccgagatgagctgcttcggaccttgctgctcaaacacagccatgccaaagacctg
gaggacctgggaagtgtgaagcccgtggttctgacacgctctggggaccccctcgagcct
ctgctcccccagtacccgtcactggagacacagctcttctgtgtgaagggagacaggggc
acagaagagcaattgtcatctggaattctggaaaagataaccccaggctcagaggccacc
ctggtgctagtgggctgcacctccttcctagagcggcctgtgctgggtttcgtgcggctg
caggaggcctcagagctggaggccctgaagctgccagtgcctgtgcgcttcctctttgtg
ttgctgggccccaagaacccccacactgactacatccagcttggccgggccactgcgacc
ctcatgtcagagagggtgttccgcacagatgcgtacctagcccagaaccgggaggagctg
gtgcgctccctggaaggctttctggattgcagcctggtgctgcccccgacggatgccccc
tctgagcaggccctgcttggtctggtgcccgtgcagaaggagctgctgcggaggcgctat
ctgccccactccgcgaggccagaacccgacttctacaaggatctaggtacctgccccagc
ccagcccaaggcttcctgagcccctacagattctcggataccccccacagccctgtgaac
tcctgcctcccctgaacagccccacttgccgtcaagtactcctccctgtcacctgccatc
acctttggcagactcctgagagaaaagaccgggaaccagatgggtgtttcagagctgctc
atctccactgcggtgcagggcgttctcttctccctgctgggggctcagcctctgcttgtg
gttggcttctcaggacccctgcttgtgtttgaggaagccttcttctcgttctgtgtggac
aatggcctggagtacattgtgggccgtgtgtggatcggcttctggctcatcctgctggtg
gtgctggtggtggccttcgagggcagcttcctggtccgcttcatctcacgctacacccag
gagatcttctccttcctcatctccctgatcttcatatatgagaccttctccaagctgatc
aagatattccaggaccacccactgcagaagcactacaatgtgacagtggacccccaactc
aaggttcccctgcctaatacagccctcctctcccttgtgcttatggctggcaccttcttc
tttgccatgatgctgcgcaagttcaagaacagctcctacttccctggaaagttgcgcaga
gtcatcggagactttggggtccccatctccatcttaatcatggtcatggtggatttcttc
atcaaggacacctacacgcagaaactcaaagtgcccaaaggcctcacggtatccgaccct
acaactcggggctgggtcatccacccgctgggcttgaattcccccttccccatctggatg
atgttcgcctctgccgtgcctgccctgctggtcttcatcctcatcttccttgagtcccag
atcaccacgctgattatcagcaaaccagagcgcaagatggtcaagggctctggcttccac
ctcgacctgctgctggtcatgggcatgggcggagcagccgccctctttgggatgccctgg
ctcagtgccaccaccgtgcgttcagtcacccacgccaacgccctcaccgtcatgagcaag
gccaaaacccctggggctgcagcccagatccagggggtcaaggagcagcggatcagtggg
ctcttggttgctatgcttgtgggcctgtccatcctcatggagcctatcctgtccctcatc
cccctggctgtgctgtttggcatcttcctctacatgggggtcacatccctcagtggcatc
cagctcttcgatcgcatcttgctcctgttcaagccgcccaagtaccacccggatgtgccc
tacgtcaagcgggtgaagacctggcgcatgcacctgttcacgggcacccagatcatctgc
ctggtagtgctctgggtggtgaagtccacacctgcctcactggctctgccctttgtcctc
atcctcactgtgcccctgcggcgctttctgctgccgctcatcttccggaaacttgagctt
cagtgtctggatgccgatgatgccaaggtgatatctgatgagaaggaaggtcaggatgag
tatgatgaggtgcccatgcccgtgtga

DBGET integrated database retrieval system