KEGG   Loxodonta africana (African savanna elephant): 100677368
Entry
100677368         CDS       T04351                                 

Gene name
NPEPPS
Definition
(RefSeq) puromycin-sensitive aminopeptidase
  KO
K08776  puromycin-sensitive aminopeptidase [EC:3.4.11.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100677368 (NPEPPS)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100677368 (NPEPPS)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M1
   100677368 (NPEPPS)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100677368
NCBI-ProteinID: XP_010592677
Position
Unknown
AA seq 860 aa
MVPTSYGLFSNFLCLCVLEPLHHILQVRQATNQIVMNCADIDIITASYAPEGDEEIHATG
FNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQF
EATDARRAFPCWDEPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTP
VMSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVP
YPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWF
GNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPI
EVSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLMKFQQKNAATEDLW
ESLENASGKPIAAVMNTWTKQMGFPLIYVESEQVEDDRVLRLSQRKFCASGPYVGEDCPQ
WMVPITISTSEDSSLAKLKILMDKPEMNVVLKNVKPDQWVKLNLGTVGFFRTQYSSAMLE
SLLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEVLKVMEAFVNEPNYTVWSDLSCNL
GILSTLLSHTDFYEEIQEFVKDIFSPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGHK
ATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDSTTLDIMLKLHKQADMQEEKNRI
ERVLGATLSPELIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELY
NRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLK
RDAESIHQYLLQRKASPPTV
NT seq 2583 nt   +upstreamnt  +downstreamnt
atggtaccaacttcctatggattgttctccaactttttgtgtctctgtgttttggaaccc
cttcatcatattctgcaggtgaggcaggcaaccaatcagattgtgatgaattgtgctgat
attgatattattacagcttcatatgcaccagagggagatgaagaaatacatgctacagga
tttaactatcagaatgaagatgaaaaagttaccttgtcttttcctagcactctccaaacg
ggtacaggaaccttaaagatagattttgttggagagctgaatgacaaaatgaagggtttc
tatagaagtaaatatactaccccttctggagaggtgcgctatgctgctgtcacacagttt
gaggctactgatgcgcggagggcttttccttgctgggatgagcctgccatcaaagcaact
tttgatatttcattggttgttcctaaagacagagtagctttatcaaacatgaatgtaatt
gaccggaaaccataccctgatgatgaaaatttagtggaagtgaagtttgccaggacacct
gtcatgtctacatacctagtggcgtttgttgtgggtgaatacgactttgtagaaacaagg
tcaaaagatggtgtgtgtgtccgtgtttacacccctgttggcaaagcagagcaaggaaaa
tttgctttagaggttgctgctaaaaccctgcctttttataaggactacttcaatgttcct
tatcctctacctaaaattgatctcattgctattgcagactttgcagctggtgccatggag
aactggggccttgttacttatagggagactgcattgcttattgatccaaaaaactcctgt
tcttcatcacgccagtgggttgctctggttgtaggacatgaactcgcccatcaatggttt
ggaaatcttgttactatggaatggtggactcatctttggttaaatgaaggctttgcttcc
tggattgaatatctgtgtgtagaccactgcttcccagagtatgatatctggactcagttt
gtttctgctgattatacccgtgcccaggagcttgatgccttggataacagccatcctatt
gaagtcagtgtgggccatccgtctgaggttgacgagatatttgatgcaatatcatatagc
aaaggtgcatctgtcatccggatgctgcatgactacattggggataaggactttaagaaa
ggaatgaacatgtacttaatgaagttccaacaaaaaaacgctgccacagaggatctctgg
gaaagtttagaaaatgctagtggtaaacccatagctgctgtgatgaatacctggaccaaa
caaatgggattccccctcatttatgtggaatcagaacaggtagaagatgacagagtactg
aggttgtcccaaaggaagttttgtgccagtggaccatatgttggagaagactgtccccag
tggatggtacctatcacaatctctactagtgaagattccagcctcgccaaactgaaaatt
ctaatggacaaaccagagatgaatgtggttttgaaaaatgtcaaaccagaccagtgggtg
aagttaaacctgggaacagttgggtttttccggacccagtacagctcggccatgctggaa
agtttattaccgggcattcgtgacctttctctgcccccagtagatagacttggactacag
aatgacctcttctccttggctcgagctggaatcattagcactgtagaggttctaaaagtc
atggaggcttttgtgaatgagcccaattatactgtatggagcgacctgagctgtaacctg
ggaattctctcaactctcttgtcccacacagacttctatgaggaaatccaggagtttgtg
aaagatatcttttcacctataggggagagactgggctgggaccccaaacctggagaaggt
catctagatgcactcctgaggggcttggttctgggcaaactaggaaaagcaggacataag
gcaacgttagaagaagcccgccgtcggtttaaggaccatgtggaagggaaacagattctt
tccgctgatctgaggagtcctgtctacctgactgttttgaagcatggtgatagcactacc
ttagacattatgctaaagcttcacaaacaagcagatatgcaggaagagaaaaaccgaatt
gaaagagtccttggggccactctttcacctgagctgattcaaaaagttctcacctttgca
ctttcagaagaggtacgtccacaggatactgtatcagtaattggtggggtggctggaggc
agcaagcatggaaggaaagctgcttggaaatttataaaggacaactgggaagagctttat
aatcgataccagggaggattcttaatatccagactaataaagctgtcagtggaaggattt
gcagttgacaaaatggccggagaggttaaggctttcttcgagagtcacccagctccttca
gctgaacgtaccatccagcagtgttgtgaaaatatcctgctgaatgctgcttggctaaag
cgagatgctgagagcatccaccagtacctccttcagcgaaaggcctcaccacccacagtg
tga

DBGET integrated database retrieval system