KEGG   Loxodonta africana (African savanna elephant): 100677496Help
Entry
100677496         CDS       T04351                                 

Gene name
DPP3
Definition
(RefSeq) dipeptidyl peptidase 3 isoform X1
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lav01002]
    100677496 (DPP3)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     100677496 (DPP3)
Peptidases [BR:lav01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   100677496 (DPP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 100677496
NCBI-ProteinID: XP_003419608
UniProt: G3T8L7
Position
Unknown
AA seq 737 aa AA seqDB search
MADTQYILPNDIGVSSLDCREAFRLLSPTERIYAHHLSRAAWYGGLAVLLQTSPEAPYIY
ALLSRLFRAQDPDQLRHHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFIPNLPK
EKLERVILGSVAAQQHPEEVKGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGDCTMED
AKLAQDFLDSQNFSAYNTRLFKEAGQDGKARYEVRLASVLGTESSVDSEVTSKLKSYEFQ
GSCFQVTRGDYAPILHKVVEHLKKAKAYAANSHQEQMLAQYMDSFMQGSIEAHKRGSRFW
IQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMSAKFERLVASAEQLLKELPWP
PAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATK
REKLTFLDEDDKDLYIRWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPE
TGERIESWYRSGETWDSKFSTIASSYEECRAESVGLYLCLNPQVLEIFGFEGADAEDVIY
VNWLNMVRAGLLALEFYTPEASSWRQAHMQARFVILKVLLEAGEGLVTITATTGSDGRPD
ARVRLDRSKIRSVGKPALERFLQRLQVLKSTGDVAGGRVLYEGYAAVTDAPPECFLTLRD
TVLLRKESRKLIVQPNTRLEGSEVQLLEYEASAAGLIRSFSERFPEDGPELEEVLTQLAT
ADARFWKAPREVPAGQA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcggatacccagtacatcctgcccaatgacatcggtgtgtctagcttggactgccgc
gaggccttccggctgctgtcgcccacagagcgcatctatgcccaccacctgtcacgggct
gcctggtatgggggcctggctgtactgctgcaaacctcccctgaggccccctacatctac
gccttgctcagccgcctcttcagggcccaggaccccgaccagctgcgccaccacgccctg
gccgagggccttactgaggaggagtatcaggcattcctggtctatgctgctggtgtctac
tccaacatgggcaactacaagtccttcggtgataccaagtttatccccaacttgcccaag
gagaagctggaacgggtgatcctggggagtgtggccgctcagcagcaccctgaagaagtc
aagggcctctggcagacctgtggggagctcatgttctctctggagccacggcttcgacac
ctggggctggggaaggagggaatcaccacctatttctctggggattgtaccatggaagat
gccaaactagcccaagactttctggactctcagaactttagtgcctacaacacgcggctc
ttcaaggaagccggccaggatgggaaggctcgctatgaggtgcggctggcttccgtgctt
ggcacagagtcttctgtggactctgaagtgacttccaagctgaagagctatgaattccag
gggagctgcttccaggtgacccggggggactatgcacccatcctccacaaggtggtggag
catctgaagaaagccaaggcgtatgcagccaacagccaccaggagcagatgctggcccag
tacatggacagcttcatgcagggctccatcgaggcccataagaggggctcccgcttctgg
atccaggacaaaggtcccatcgtggagagttacatcgggttcatcgagagctaccgtgac
ccctttggttcccgtggagagtttgaaggcttcgtggccatggtgaacaaggccatgagt
gccaagttcgagcggctggtggcaagtgcagaacagctgctgaaggagctcccctggccc
ccagccttcgagaaggacaagttcctcacccctgacttcacctccctggatgtcctcacc
ttcgccggctccggcatccctgccggcatcaacatccccaactatgatgacttgaggcag
acagaaggctttaagaacgtgtcgctggggaacgtgctggctgtggcctatgccacgaag
cgggagaagctcaccttcctggatgaggatgacaaggacctgtacatccgctggaagggg
ccttccttcgacgtgcaggtgggcctgcacgagctactgggccacggcagcggcaagctc
tttgtgcaggatgagaaaggagcattcaacttcgaccaggagaccgtgatcaacccagag
acgggggagcggattgagagttggtaccggagcggggagacgtgggacagcaagttcagc
accattgcctccagctacgaagagtgccgggctgagagtgtgggcctctacctctgcctc
aacccccaagtgctggagatctttggcttcgagggggctgatgcggaagacgtgatctac
gtgaactggctcaacatggttcgggctgggctgctggctctggagttctacacccctgag
gcctccagctggagacaggcccacatgcaggcccggtttgtgatactgaaggtcttgctg
gaggctggcgaggggctcgttaccatcactgccaccacaggctctgacgggcgcccggat
gcccgggtccgccttgaccgaagcaagatccgttccgtgggtaagcctgccctggagcgg
ttcctgcagagactccaggtgctgaagtccacgggggatgtagccggagggcgggtcctg
tatgaggggtatgcggccgtcacagacgcaccccctgagtgcttcctcaccctcagggac
acagtcctgctgcgcaaggaatctcggaaactcatcgttcagcccaacactcgcctcgaa
ggctcagaagtacagcttcttgagtacgaggcctcagctgctggcctcatccgatccttc
tctgagcgcttccccgaggacggacccgagttggaggaggtcctcacccagctggccacg
gccgatgcccggttctggaaggccccccgtgaggtcccagctggccaggcttga

DBGET integrated database retrieval system