KEGG   Loxodonta africana (African savanna elephant): 100677744Help
Entry
100677744         CDS       T04351                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1-like isoform X2
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00232  Caffeine metabolism
lav00983  Drug metabolism - other enzymes
lav01100  Metabolic pathways
lav05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100677744
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100677744
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100677744
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100677744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 100677744
NCBI-ProteinID: XP_003412540
Position
Unknown
AA seq 290 aa AA seqDB search
MDIEAYFERIGYTDTGRKLDLETLTDILQHQIRAIPFENLNMHCGKAMEFDLEAVFDQIV
RRKRGGWCLQVNHLLYWALTTMGFETTMLGGYVYITPVDEYSSNMVHLLLQVTIDGRNYI
VDAGFGCSYQMWQPVELISGKDQPQTPGIFSLREEGAIWYLDQIRREQYIPNQEFLNSNL
LDKHKYRKIYSFTLKPRSIEDFESVNTYLQTSPTSMFTGVSLCSLQTPEGVYCLVGFTLT
SQRFNYKDNMDLVEFKDLNENEVEETLKNLFNISLEGKLAPKHGDWLFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatattttgaaagaattgggtatacagacactgggaggaaattggac
ttggaaacattaactgacatccttcaacaccagatccgagccattcccttcgagaacctt
aatatgcactgtggaaaagccatggagttcgacttagaggccgtttttgatcaaattgtg
aggaggaagcgaggtgggtggtgtctccaggtcaaccacctcctgtactgggctctgacc
acaatgggttttgagaccacaatgttgggaggttatgtttacatcactccagtcgacgaa
tatagcagcaacatggttcacctcctgcttcaggtgaccatagatggcaggaactacatc
gtggatgctgggtttggatgctcctaccagatgtggcagcctgtggagctaatttctggg
aaggatcagccccagacacctggcatcttcagcttgagagaagagggtgcaatctggtac
ctggaccaaatcaggagagagcagtacattccaaaccaggaatttcttaattctaatctc
ctagataaacataaataccgaaaaatctactctttcacactcaagcctcgatcaattgaa
gattttgagtctgtgaatacataccttcaaacatctccaacatctatgtttacaggtgta
tctctttgttccttgcagacgccagaaggggtttactgtttagtgggcttcaccctcacc
tctcaaagattcaattataaggacaatatggacctggtagagtttaaggacctaaatgag
aatgaagtagaagagacattgaagaatctatttaatatctctttggagggaaagcttgca
cccaaacatggcgactggctttttaccatttag

DBGET integrated database retrieval system