KEGG   Loxodonta africana (African savanna elephant): 111747762Help
Entry
111747762         CDS       T04351                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK3-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    111747762
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    111747762
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111747762
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  Wnk family
   111747762
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111747762
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 111747762
NCBI-ProteinID: XP_023395107
Position
Unknown
AA seq 719 aa AA seqDB search
MCSFFSTDESAPQSSPVGRWRFCINQTIRNHEAQSPPLQHSLSIVPGLQPLYSQRNTSNK
EISQDTLPTIENNPCQHALFTFESEHKDLVDGKISEYASVETEQPALLYQVEDDRQILAP
VTSSSSYTTTSVCAIPVECEGFTNQACIFLPVYPYRQAASQADILMTHPGESTQIAGNSL
TTPAFMSDQKPQSLLVQQPTVDAEFIYQEGETTVNTEASSLKTVIPTQTPGLEPTTFLPT
TILESDGERPPKMEFADNRIKTLDEKLRNLLYQEHSISVIYPESQKDTQSIDSPFSSSAE
DTLSCSVPEVIAISHCGIQDSPAQSSNFQERGSKILSNVAVSQPANLSVFKRDLNVITSV
PSELCLHKIYLNNFFSAYNLAKLSVETEDTRSTVAPDPIPLTRESIADTRALSRCKVMSG
SFQRGRFQVITVPQQQSMKVTSFGIEHIPAFSQMANHSNEETLVFTETEKSQLIEMEPAV
HSPQTSFSFQKLQALYETVKEDKGIPKQGDFLSFSTDCETGISFMTPEKELEETLAAGST
MQPESELLHKERETLPIRKQPNSDSELSAPLAGNENSVAKTVPESDQCHEEQACVQTQNS
LFYSPSSPMSSDDESEIEDEDLKVELQRLREKHIQEVVNLQTQQNKELQELYERLRSIKD
SKTQSSEIPLPPASPRRPRSFKSKLRSRPQSLTHVDNSIVGTGKSVIKVKKTKKTSGQR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcatttttttctacagatgagtctgcccctcagtcatccccagttggtcggtgg
cgattctgtatcaatcaaacaataagaaatcatgaggctcagtctcctcctcttcagcat
tctctgtctatagttcctgggctacagccactttatagtcagagaaacacaagtaataag
gaaatatcacaagacacactgcccactatagaaaataatccatgccagcatgcacttttt
accttcgagtcagaacacaaggatttagttgatggtaagatttctgaatatgctagtgta
gaaactgagcagccagctctactttatcaagtggaagatgacaggcagatattggcacca
gttactagtagttccagttatactactacttcagtttgtgccattccagttgaatgtgag
ggattcaccaaccaggcatgcatattcctacctgtgtatccgtatcgtcaagctgccagt
caagctgatatacttatgacccatcccggagagtcaacccagattgctggtaactctctt
acaactccagcatttatgtctgatcaaaagcctcaatccttattggtacagcagccaact
gtggatgcagaatttatttaccaagaaggagaaaccacagtgaacactgaagcaagttct
cttaaaacagtcattcccactcagaccccaggccttgaaccaactacctttctacctacg
actatcctggaatcagatggggaaagacctccaaaaatggagtttgcagacaaccgaatt
aaaactctggatgaaaaattaagaaacttgctctatcaggagcatagtatatctgtcatc
tatcctgagagtcagaaggatacccaaagcatagactctccattttcttcctctgctgaa
gatacactgtcctgttcagtgccagaagtcatagccatcagtcactgtggaattcaagat
agtcctgcacaatcctctaattttcaggagagaggctctaagattctgtccaatgtggct
gtgagtcagcctgctaacctatcagtgttcaaaagggacctgaatgtgataacttctgtg
cccagcgaattgtgtttgcataaaatttatcttaacaattttttttctgcttacaatttg
gcaaaactttcagtggaaacagaagatacgagatcaacagttgctcctgatcccattcct
ttgacacgagagtccatagctgatactagggctttgagtagatgcaaagtgatgagtgga
tcatttcagcggggtcggttccaggtgattacagttcctcagcaacagtcgatgaaagtg
acatcttttggaatagagcacataccagctttcagtcaaatggcaaaccattctaatgaa
gagactctagtatttactgaaacagaaaagtctcagttgatagaaatggaacctgctgtg
cacagtccacaaacttcattttcttttcagaagttacaagctctttatgaaaccgttaaa
gaagataaaggaattcccaaacaaggtgacttcttgtctttcagcacagattgtgagact
ggtatatcttttatgacaccagaaaaggaattggaagaaactttagctgcaggaagtact
atgcagcctgaatctgaactgttgcataaagagagagaaacactgcctattaggaaacag
cctaactctgatagtgaactttcagcccctcttgctggcaatgaaaactcagtagcaaag
actgttccagagagtgatcagtgccatgaagaacaagcctgtgttcaaacacagaactca
ctcttctattcaccatcttccccaatgagcagtgatgatgagtcagaaatagaggatgag
gacttgaaggtggagcttcaaagattacgagaaaaacacattcaggaggtggtaaatctt
caaacccagcagaataaggagctgcaggagctctatgaacgccttcggtcaattaaagat
agtaaaactcaatcctcggagattcctctgccacctgcatcaccacgtcgaccaagatct
ttcaaaagcaaacttcgaagccgcccccagtccttgacacatgtggataatagcatagtt
ggtacaggtaaatcagtcataaaagtgaaaaaaacaaaaaaaacctctggtcaaagataa

DBGET integrated database retrieval system