KEGG   Loxodonta africana (African savanna elephant): 808790Help
Entry
808790            CDS       T04351                                 

Gene name
COX2
Definition
(RefSeq) cytochrome c oxidase subunit II
  KO
K02261  cytochrome c oxidase subunit 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00190  Oxidative phosphorylation
lav01100  Metabolic pathways
lav04260  Cardiac muscle contraction
lav04714  Thermogenesis
lav04932  Non-alcoholic fatty liver disease (NAFLD)
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    808790 (COX2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    808790 (COX2)
  09159 Environmental adaptation
   04714 Thermogenesis
    808790 (COX2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    808790 (COX2)
   05012 Parkinson disease
    808790 (COX2)
   05016 Huntington disease
    808790 (COX2)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    808790 (COX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lav03029]
    808790 (COX2)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    808790 (COX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX2 COX2_TM MRAP
Motif
Other DBs
NCBI-GeneID: 808790
NCBI-ProteinID: NP_009282
UniProt: Q9TA26 B7XBM5
Position
MT
AA seq 228 aa AA seqDB search
MAYPLQLGFQDATSPVMEELLHFHDHTLMIIFLISSLVLYIIMLMLTSKLVHTNMMNVQE
MEMIWTILPAIILILIALPSLHTLYMMDEINNPLLTIKTMGHQWFWSYEYTDYEDLAFDS
YMITTDSLKFGELRLLEVDNRMVLPTDLPVRVLVSSEDVLHSWAVPSLGLKTDAIPGRLN
QVTLTSMRPGLFYGQCSEICGANHSFMPIVLELVPLKYFENWSASLAQ
NT seq 685 nt NT seq  +upstreamnt  +downstreamnt
atggcctatccgttacaattggggttccaagatgccacatctcctgttatagaagaactc
cttcacttccatgaccacaccctaataatcattttccttattagctccttagtcttgtat
attattatgcttatattaacttctaagctagtccatacaaatataataaacgtccaagag
atagaaataatctgaaccattctcccagctattatccttatcttaattgccctgccctct
ttacacactctgtatataatagatgaaatcaataaccccctattaacaatcaagaccata
ggacaccaatgattctggagttatgaatatactgattacgaagatttagctttcgactca
tacataatcactactgatagcctaaaatttggagaacttcgattattagaggtagacaat
cggatggtattacctacagacctaccagttcgagtactagtctcatcagaagatgttctc
cattcatgggctgttccatctctaggtctaaaaacagatgcaattccaggacgacttaat
caagtaactttaacatcaatacgacctggcttattttatggtcagtgttccgaaatctgc
ggagcaaaccatagcttcataccaattgtcctagaactagttccacttaaatactttgaa
aactggtcagcatcactagcacaat

DBGET integrated database retrieval system