KEGG   Lactobacillus sp. wkB8: LACWKB8_0328Help
Entry
LACWKB8_0328      CDS       T03355                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
law  Lactobacillus sp. wkB8
Pathway
law00051  Fructose and mannose metabolism
law01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:law00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LACWKB8_0328
Enzymes [BR:law01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LACWKB8_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N UPF0052 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIS08644
Position
330817..331965
Genome map
AA seq 382 aa AA seqDB search
MKAVHFGAGNIGRGFIGETLAANDFAITFVDVNDTIINELNKRKEYNIEMAAEGQQKITV
KNVCGINNGQNPEAVVAAIAHTDLVTTAIGPKILQFIAPLIAQGISARKNSGNEEKLDCI
ACENMIGGSQLLKKEVYQHLNDDDKEYCEQYIGFPNAAVDRIVPLQKHDDPLLVSVEPFK
EWIVDESQMANPSLKLTGVDYAPDLEPYIERKLFSVNTGHATVAYTGKTLGYTNIGEAIK
DERVLNQLKGVLQETGALLIAKWHFDPAQHAQYQKKIIQRFENPYISDTIARVGRTPIRK
LGYDERFIRPIREAKKRGLKYDKLLETVAKIYQFDVPSDDESVKLQQIIQNKFAEVVKET
TGLQDQDLIGEIATQISAEFKK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttcattttggagcaggtaatattggtagagggtttattggggaaactctt
gccgctaatgattttgcaattacatttgttgacgttaatgacaccatcattaatgaactt
aataaacgtaaggaatacaacattgaaatggctgcagaagggcaacagaaaattactgtc
aaaaatgtttgcggcataaataatggacaaaatccagaagcagtggtcgctgccattgct
cacacagatttagtgaccacagctattggacccaagattttgcagtttattgctccactg
attgcacaagggatcagtgcccgtaagaatagtggcaatgaagaaaaacttgattgcata
gcttgtgagaatatgattggcggttcacaattattaaaaaaggaagtctatcaacattta
aacgatgatgataaagaatactgcgagcaatatattggctttcccaatgcagctgtagac
cgtattgttcctttacaaaagcatgatgatccgctgcttgtctcagtggagccgtttaaa
gaatggatagttgatgaatctcagatggctaatccatctttaaaattaactggagttgat
tatgcacctgatttggaaccatatattgagcgcaaattattttcggttaacactgggcac
gctacggttgcctatactggaaaaactctagggtacaccaatattggcgaagcgattaaa
gatgaacgagtattaaaccaactaaaaggtgttttgcaagaaactggtgctctgctaatt
gctaaatggcattttgatcctgctcaacatgcacagtaccaaaagaaaatcattcagcgt
tttgaaaatccatacatttccgatactatagctcgcgtcggacgcaccccaattcgcaag
ttaggttatgatgaaagatttatcagaccaattcgtgaagctaagaaacggggattaaag
tatgacaagttgcttgaaacggtggcaaaaatataccagtttgatgttccaagcgatgat
gaaagtgtcaaactacagcagataatccagaataaatttgctgaagtagttaaagaaaca
accggcttgcaagatcaagatttgattggtgaaattgctactcaaatatcagcagaattt
aaaaaataa

DBGET integrated database retrieval system