KEGG   Lactobacillus sp. wkB8: LACWKB8_0614Help
Entry
LACWKB8_0614      CDS       T03355                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
law  Lactobacillus sp. wkB8
Pathway
law00071  Fatty acid degradation
law00072  Synthesis and degradation of ketone bodies
law00280  Valine, leucine and isoleucine degradation
law00310  Lysine degradation
law00362  Benzoate degradation
law00620  Pyruvate metabolism
law00630  Glyoxylate and dicarboxylate metabolism
law00640  Propanoate metabolism
law00650  Butanoate metabolism
law00900  Terpenoid backbone biosynthesis
law01100  Metabolic pathways
law01110  Biosynthesis of secondary metabolites
law01120  Microbial metabolism in diverse environments
law01130  Biosynthesis of antibiotics
law01200  Carbon metabolism
law01212  Fatty acid metabolism
law02020  Two-component system
Brite
KEGG Orthology (KO) [BR:law00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LACWKB8_0614
   00630 Glyoxylate and dicarboxylate metabolism
    LACWKB8_0614
   00640 Propanoate metabolism
    LACWKB8_0614
   00650 Butanoate metabolism
    LACWKB8_0614
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LACWKB8_0614
   00072 Synthesis and degradation of ketone bodies
    LACWKB8_0614
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LACWKB8_0614
   00310 Lysine degradation
    LACWKB8_0614
   00380 Tryptophan metabolism
    LACWKB8_0614
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LACWKB8_0614
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LACWKB8_0614
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LACWKB8_0614
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:law04147]
    LACWKB8_0614
Enzymes [BR:law01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LACWKB8_0614
Exosome [BR:law04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LACWKB8_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIS08888
UniProt: A0A089XXT6
Position
593360..594508
Genome map
AA seq 382 aa AA seqDB search
MKDIYIVAAKRTPFGRYRGLWAEKSAVDLGELALSATLTSIDLAAEKLDALFMGNVLGAG
LGQNMARQIALNVGMSEKSSSVTINEVCGSSLKALRVAQGQMELGDFDLVAVGGAESMTN
ATYLAKDKAKPQFQSEMLQNGLTDAFSGSHMGLTAENVAAKYGISRLEMDQYSAKSHHKA
AEIVQQDFFKDEIIAVKTNGKFVQQDETIRPDTNLDALSKLKPVFKENGLITAGNSSPLS
DGASMIILATGEKVQELNLKPLARLGSFAESGTDPAYMGMAPYFAVKKLLQKTNNTLDDY
DAIEVNEAFAAPSVALAKQLEIPEAKLNIFGGAIALGHPLAATGTRLVGTAINIMNHING
RKALVTLCIGGGQAIACEVERC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatttatattgttgcagctaaaaggactccttttggtcggtatcgcggcttg
tgggcagaaaaaagcgctgtcgatttgggcgaattagcactatcagcaactttaacaagc
attgatttagcagctgaaaaacttgatgcgctatttatgggcaatgttttaggagctggt
ttaggtcaaaatatggctcggcaaattgctttaaatgttggaatgagtgaaaagagcagt
agcgttaccatcaatgaagtttgcggttcaagcctgaaagcacttcgcgtggctcaagga
caaatggagttaggtgactttgacttagtggctgtgggcggcgcagaaagtatgactaat
gcgacttatttggcaaaagataaagcaaagccccagtttcagagcgaaatgctccaaaat
ggtctaactgatgctttttccggttcacacatgggattaactgccgaaaatgtggctgca
aaatatggtattagtcgcttagaaatggatcaatatagtgcaaagtcgcatcacaaagca
gcagaaattgtccaacaggatttttttaaagacgaaataattgctgtaaaaactaacgga
aaatttgtccagcaggatgaaacgatccgtccagatactaatttagatgcgctaagcaaa
ctaaagcctgtttttaaagaaaatggtttaatcactgccggtaattcttcaccattaagt
gacggcgccagtatgattattttggcgactggcgagaaagtccaagaattaaacttaaaa
ccacttgcgcgactaggctcatttgctgaatcaggtactgatcccgcatatatgggcatg
gcgccttattttgcagtcaaaaaattattgcaaaaaacaaataacacgctagatgattac
gatgcaattgaagttaatgaagcttttgctgctccaagtgttgctctagctaagcagctg
gaaattccagaggccaagctaaatatttttggtggcgctattgctttagggcacccactg
gctgccacaggtactcgcttagtggggacagcaatcaacatcatgaatcacatcaatggt
cgcaaagcgctagttaccctttgtatcggtggcggacaggcaatcgcatgtgaagttgag
agatgttaa

DBGET integrated database retrieval system