KEGG   Leclercia adecarboxylata: APT61_04280Help
Entry
APT61_04280       CDS       T04232                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lax  Leclercia adecarboxylata
Pathway
lax00071  Fatty acid degradation
lax00362  Benzoate degradation
lax00380  Tryptophan metabolism
lax00620  Pyruvate metabolism
lax00640  Propanoate metabolism
lax00650  Butanoate metabolism
lax00900  Terpenoid backbone biosynthesis
lax01100  Metabolic pathways
lax01110  Biosynthesis of secondary metabolites
lax01120  Microbial metabolism in diverse environments
lax01130  Biosynthesis of antibiotics
lax01200  Carbon metabolism
lax01212  Fatty acid metabolism
lax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APT61_04280
   00630 Glyoxylate and dicarboxylate metabolism
    APT61_04280
   00640 Propanoate metabolism
    APT61_04280
   00650 Butanoate metabolism
    APT61_04280
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APT61_04280
   00072 Synthesis and degradation of ketone bodies
    APT61_04280
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APT61_04280
   00310 Lysine degradation
    APT61_04280
   00380 Tryptophan metabolism
    APT61_04280
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APT61_04280
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APT61_04280
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APT61_04280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lax04147]
    APT61_04280
Enzymes [BR:lax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     APT61_04280
Exosome [BR:lax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APT61_04280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALZ95263
UniProt: A0A2X1RWH8
Position
890327..891505
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALSRHSAVDLGSVVVRALVERSGVEAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRERQDAYAL
SSQQKARAAIDAGRFRDEIVPVNAQKQNGEPLLVDTDEQPRTDTSAEGLALLNPAFDITG
SVTAGNASSINDGAAAVMMMSESKAEALNLPVLARIKAFASVGVDPALMGIAPVHATRRC
LERAGWQLADVDLIEVNEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILV
SLVHEMVKRDARKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgtcgtgatagtgggtgcgttgcgcacagcaattggctgtttccagggagcg
ctctcacgccactcggcggtagatctgggcagcgtggtggttcgcgcgctggtggagcgc
agtggcgttgaggcccacgagatcgacgaggtgatcctcggccaggtgctgaccgccgga
gccgggcaaaacccggcccgtcaggccgcactgaaaggtggcttacccaataccgtctct
gcgattaccatcaacgacgtgtgcggctccgggctgaaggcgctgcaccttgccacccag
gcgatccagtgcggtgaagcggatgtggtgatcgccggcggccaggagaatatgagccgt
gcgccgcacgtcctgaccgatagccgcacgggtgctcaactgggcaacagccagcttatc
gacagcctggtgcatgacgggctatgggatgcgttcaacgattaccatatgggcgtcacg
gctgaaaacctggcacgagaatatggtatctcccgtgaacggcaggacgcctatgcgctt
agctcgcagcagaaggcccgggccgccattgacgcaggccgcttccgggatgagattgtc
ccggttaacgcgcagaagcagaacggtgagccactgctggtcgataccgatgaacagccg
cgcaccgacaccagcgccgaagggctggcgttactcaatcctgcctttgatatcaccggt
tcggtcaccgccgggaatgcttcttccatcaacgacggcgccgccgcggtgatgatgatg
agcgagagtaaagctgaagcgctgaacctgccggtgctggcgcgcatcaaagcctttgcc
agcgttggcgtggatcctgctttaatgggcatcgcgccggtgcatgccacgcgtcgctgt
ctggagcgggcagggtggcagctggcggatgtcgatctgatcgaagtgaacgaagccttt
gctgctcaggcgctgtcggtgggcaaaatgctggagtgggatgagcgccgggtcaatgtc
aacggcggggcgattgcgctgggacaccccatcggcgcgtcaggctgccgtattctggtc
tcgctggtgcatgagatggtgaaacgcgatgcccgtaaagggctggcgacgctgtgcatt
ggcggcgggcagggcgtggccttagccatagaacgataa

DBGET integrated database retrieval system