KEGG   Leclercia adecarboxylata: APT61_06735Help
Entry
APT61_06735       CDS       T04232                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
lax  Leclercia adecarboxylata
Pathway
lax02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lax00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    APT61_06735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lax02000]
    APT61_06735
Transporters [BR:lax02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    APT61_06735
   Histidine transporter
    APT61_06735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ALZ95712
UniProt: A0A358HC80
Position
1442297..1442983
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGALVTLELALSSVVLAVLIGLAGAGAKLSTNRALVLLFEGYTTLIRGVP
DLVLMLLIFYGLQIALNGITDAIGMAQIDIDPMVAGIITLGFIYGAYFTETFRGAYLAVP
KGHIEAATAFGFTSSQTFRRIMFPAMMRFALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWEPFYFAIVCGLIYLVFTTVSNGVLLLLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacggattttctggcgtaattttacaaggcgcactcgtcacccttgaactggct
ctcagttcggtggtgctggcggtgttaataggcctggcgggcgcgggcgcgaagctttcg
accaatcgggcactggttctgctgtttgaaggctataccaccctgatccgtggtgtgcct
gacctggtgctaatgctgctgattttctacggtctgcaaatcgctctcaacggcattacg
gatgccatcggtatggcgcagattgatatcgatcctatggtggccggtatcattaccctg
ggctttatctacggggcctactttactgaaaccttccgcggagcctatctcgcagtgccg
aaagggcatatcgaagcggccactgcattcggttttacctcctctcaaaccttccgccgt
attatgtttccggccatgatgcgctttgcgctgccgggcatcggcaacaactggcaggtt
atcctcaaggcaacggcgctggtctcgttactggggctggaagatgtggtgaaagccacg
cagctcgcgggcaaaagcacctgggaaccgttctacttcgccatcgtgtgcgggctgatt
tatctggtgtttaccaccgtttccaatggtgtgctgctgctgctcgagcgtcgctactcc
gtgggtgtgaagagggctgacctgtga

DBGET integrated database retrieval system