KEGG   Leclercia adecarboxylata: APT61_20400Help
Entry
APT61_20400       CDS       T04232                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
lax  Leclercia adecarboxylata
Pathway
lax00564  Glycerophospholipid metabolism
lax01100  Metabolic pathways
lax01110  Biosynthesis of secondary metabolites
Module
lax_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:lax00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    APT61_20400 (psd)
Enzymes [BR:lax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     APT61_20400 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_C48
Motif
Other DBs
NCBI-ProteinID: ALZ98247
UniProt: A0A3E1ZRN8
Position
4401053..4402021
Genome map
AA seq 322 aa AA seqDB search
MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMREAQKPDTASY
RTFNDFFVRPLRDEVRPLNTDPNVLVMPADGVISQLGAIENDKILQAKGHNYSLEALLAG
NYLMADLFRNGSFATTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNHLTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGVIKRWTWPEGESEGSVA
LLKGQEMGRFKLGSTVINLFAPGKVKLVEQLESLSVTKLGQPLAVSTEPFVTTDAEPAPL
SDEEIAAELEASPLVDDKKDAS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaactcatttaaactttcgcttcaatacattctgccaaaactgtggctcactcgc
ctggcgggctggggcgcgagcaaacgagcgggctggctgaccaagctggtaatcgatctg
ttcgtgaaatactacaaggtcgatatgcgtgaagcgcagaagccggataccgccagctac
cgcacctttaacgatttcttcgtgcgcccactgcgcgatgaagtgcgtccgctgaatacc
gacccgaacgtgctggtgatgcctgctgacggcgtgatcagccagttgggcgcgatcgaa
aacgacaagatcctgcaggctaagggccataactacagcctggaagctttgctggcaggt
aactacctgatggcggatctgttccgcaatggttcctttgccaccacctacctgtcgcca
cgcgactatcaccgcgtgcatatgccgtgcaacggtattctgcgtgaaatgatctacgtc
ccgggcgatctgttctcggtgaaccatctaaccgcacaaaatgtcccgaacctttttgcc
cgtaacgagcgcgttatctgcctgttcgacaccgagtttggcccgatggcgcagattctg
gtgggtgccaccattgtcggcagcattgaaaccgtctgggcgggcaccattacgccaccg
cgcgaaggcgtgattaaacgctggacctggcctgagggtgaaagcgaaggctccgtggcg
ctgctgaagggtcaggagatgggccgcttcaagctcggctccactgtaatcaacctgttt
gctccgggtaaagtgaagctggtagagcagctcgaaagcctgtccgtaaccaaactcggc
cagccgctggcggtttcgacggagcctttcgtcacaacggacgcagagcctgccccgctg
tcagatgaagagattgccgctgaactcgaagccagcccgctggttgatgacaaaaaagac
gcaagctaa

DBGET integrated database retrieval system