KEGG   Lactobacillus amylovorus GRL1118: LAB52_01465Help
Entry
LAB52_01465       CDS       T01954                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
lay03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lay00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LAB52_01465 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lay03011]
    LAB52_01465 (rplV)
Ribosome [BR:lay03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LAB52_01465 (rplV)
  Bacteria
    LAB52_01465 (rplV)
  Archaea
    LAB52_01465 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEA31278
UniProt: F2M1K9
Position
298362..298715
Genome map
AA seq 117 aa AA seqDB search
MAEQISSAKAEARTVRIAPRKARLVVDLIRGKSVAEALAILEFTPRAASPIVEKVLRSAI
ANAEHNYDLESANLYVSEAYVNEGATLKRFRPRAKGMASPINKRTSHVVVVVSEKND
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaaattagttcagctaaggctgaagcaagaactgttcgcatcgctccaaga
aaagctcgtttagtcgttgacttaattcgtggcaagagcgttgctgaagcattagcaatc
ttagaatttacgcctagagctgcttccccaatcgttgaaaaagttttacgttcagctatt
gctaacgcagaacacaactacgatcttgaaagtgctaacctttacgtatcagaagcttac
gtaaacgaaggtgcaaccttgaagagattccgtccacgtgctaagggtatggcttctcca
attaacaagagaaccagtcacgtagttgtagtagtttcagaaaagaacgattaa

DBGET integrated database retrieval system