KEGG   Lactobacillus amylovorus GRL1118: LAB52_01655Help
Entry
LAB52_01655       CDS       T01954                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
lay00010  Glycolysis / Gluconeogenesis
lay00260  Glycine, serine and threonine metabolism
lay00680  Methane metabolism
lay01100  Metabolic pathways
lay01110  Biosynthesis of secondary metabolites
lay01120  Microbial metabolism in diverse environments
lay01130  Biosynthesis of antibiotics
lay01200  Carbon metabolism
lay01230  Biosynthesis of amino acids
Module
lay_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAB52_01655
  Energy metabolism
   00680 Methane metabolism
    LAB52_01655
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAB52_01655
Enzymes [BR:lay01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAB52_01655
Membrane trafficking [BR:lay04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LAB52_01655
Exosome [BR:lay04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAB52_01655
  Exosomal proteins of melanoma cells
   LAB52_01655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AEA31316
UniProt: F2M1X7
Position
319296..319973
Genome map
AA seq 225 aa AA seqDB search
MAKLVLVRHGESVANAANVYTGWNDVPLTHKGEEQAKQAGELINTISDFAPTHIHTSVLS
RAITTANIVADTCNLLWLPITKTWRLNERHYGALRGLNKDISRKVFGVEQVLLWRRGFDS
VPPAQGSPMIDRRYKLCDQHLMPRAESLHQTQKRLMPYYYDHIASRLLNGEDQLIVAHGS
SLRALIKKLENINDHDIVNLEVPNAEPIVYTMDDQLNIVDKKILH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattagtattagttcgacatggcgaaagtgttgccaatgccgcaaatgtttat
actggatggaacgatgttccattgactcacaagggtgaggagcaggctaagcaggcaggc
gaattaattaatactatctcagactttgctccaacgcatatccatacttcagtcttgtcg
cgtgctattacgacagccaatattgtcgccgatacatgtaatttgttatggctcccgatc
actaagacgtggcgactaaatgaacgtcactacggggctctacgtggccttaacaaggat
atctcgcgtaaagtattcggtgtagaacaagttttactctggcgtagaggttttgattcc
gttccacctgctcaaggttcgccaatgattgatcgtcgctataaattatgcgatcaacat
ttgatgccacgagcagaaagtttacatcaaacccaaaaacgtttgatgccatattactat
gatcatattgcttcgagattgttaaatggtgaagaccaattaatcgtagctcatggttca
agtcttcgtgctttgattaaaaagcttgaaaacattaatgatcatgacattgttaacctt
gaagtacctaatgcagaaccaattgtttatacgatggatgatcagttaaatattgttgat
aaaaagattttacattaa

DBGET integrated database retrieval system